KEGG   Canis familiaris (dog): 448806Help
Entry
448806            CDS       T01007                                 

Gene name
DBH
Definition
dopamine beta-hydroxylase (dopamine beta-monooxygenase) (EC:1.14.17.1)
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
cfa  Canis familiaris (dog)
Pathway
Tyrosine metabolism
Metabolic pathways
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    448806 (DBH)
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     448806 (DBH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
9
AA seq 625 aa AA seqDB search
MQVPSPSAREAASMYGTAVAVFLVLLVAVLQGLAPPESPLPYRIPLDPKGDLELSWDVSY
TQKTIYFQLLVQELKAGVLFGMSDRGELENADLVVLWTDGDNAYFGDAWSDQRGQIHLDS
QQDYQLLRAQRTPKGLCLLFKRPFGTCDPKDYFIEDGTVHLVYGVLEEPFGSLEAINTSG
LQKGLQRVQLLKPKISIPALPEDRRTMDIQAHNVLIPSKTTYWCHLTKLPQDFPRHHIVM
YEPIITKGNEALVHHIEIFQCTNQFQNITSFSGSCDSKEKPQELKVCRHVLAAWALGARA
FYYPEEAGLAFGGSNSSRFLLLEIHYHNPTNIRGRYDNSGIRLHYTAKLRHFNAGIMELG
LVYTPVMAIPPKESAFVLTGYCTAKCTQAALPPLGIRIFASQLHTHLTGTKVVTMLVRDG
QEIEIVNRDDHYSPNFQEIRMLKKTVYVYPGDVLITSCTYNTEDKNEATVGGLGTQEEMC
VNYIHYYPQTQLELCKSHIDPCFLQKYFHLVNRSNLGEYCTCPQASGTTCPQASGTTCPR
ASVPEQFASVPWNSFSRVVLKALYDFIPVTVHCNKSSAVRFPGKWDLQPLPEIISKLKEP
TPRCPTSRDQSSSSLTVVNIGGGKV
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtccccagccccagcgcgcgcgaggcggcctccatgtacggcacagcggtggcc
gtcttcctggtcctcctggtggccgtgctgcagggcttggccccccccgagagtcctctc
ccctaccgaatccccctggaccccaagggggacctggaactctcctgggatgtcagctac
acgcagaagaccatctatttccagctcctggtgcaagagctcaaggctggggtcctgttt
gggatgtcggaccgtggggagctggagaacgctgacctggtcgtgctctggaccgacggg
gacaatgcctattttggggatgcctggagtgaccagcggggacagatccacctggattcc
cagcaggattaccagctgctgcgggcacagaggaccccgaaaggcctatgtctactcttc
aagaggccatttggcacttgtgaccccaaggattacttcattgaggatggcaccgtccac
ctggtgtatggggtcttggaggagccttttgggtcgctggaggccatcaacacgtcgggg
ctgcagaagggactgcagagggtacagctgctgaagcccaagatctccatcccagccttg
ccggaagacaggcgcaccatggacatccaagcccacaacgtcctgatccccagcaagacc
acgtactggtgtcacctcaccaagcttccacaagacttcccccggcaccacatcgtcatg
tacgagcccatcatcaccaaggggaacgaggccctggtccaccacatagagatcttccag
tgcaccaaccagttccagaacatcacctcattcagcgggtcctgtgattccaaggagaag
ccccaagagctcaaagtctgccgccacgtgctggccgcctgggccctgggcgccagggca
ttttactacccagaggaagcaggccttgcctttgggggctccaattcctccagatttctc
cttctggaaattcactaccacaacccgacgaatatccgaggccgctatgacaactcaggc
atccgcctccactacacggccaagctgcggcacttcaacgcggggatcatggagctgggg
ctggtgtacacgcccgtgatggccatccccccgaaggagtcggccttcgtcctcaccggc
tactgcacggccaagtgcacccaggcggccctgcctcccttagggatccgcatctttgcc
tctcagctccatacacacctgaccgggacaaaggtggtcaccatgctggtccgggatggc
caagagatagagatcgtgaacagggatgaccactacagccctaacttccaggagatccgc
atgttgaagaagactgtgtatgtctacccgggggacgtgctcatcacttcctgtacatac
aacacagaagacaagaatgaggccactgtggggggcctggggacccaggaggagatgtgc
gtcaactacatccactactacccgcagacacagctggagctctgcaagagccatatagac
ccctgcttcctgcagaagtatttccacctagtgaacaggtccaacctaggggaatactgc
acctgccctcaggcttctggcaccacctgccctcaggcctctggcaccacctgcccccgg
gcctccgtccccgagcagtttgcttcggttccctggaactccttcagccgagtggtgctc
aaggccctgtatgacttcatacccgtgaccgtgcactgcaacaagtcctcagccgtccgc
ttcccgggtaaatgggatctgcaacccctgcctgagatcatctccaagctaaaagagcct
acccctaggtgcccaaccagccgggatcagagctcctccagcctcactgtggtcaacatc
ggtggaggcaaagtttga

DBGET integrated database retrieval system