KEGG   Canis familiaris (dog): 474424Help
Entry
474424            CDS       T01007                                 

Gene name
USP15
Definition
ubiquitin specific peptidase 15
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
cfa  Canis familiaris (dog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
10
AA seq 860 aa AA seqDB search
MFVKHCKVEVYLTELKLCENGNMNNVVTRRFSKADTIDTIEKEIRKIFNIPDEKETRLWN
KYMSNTFEPLNKPDSTIQDAGLYQGQVLVIEQKNEDGTWPRGPSAPKSPGASNFSALPKI
SPSSLSNNYNNINNRNVKNSNYCLPSYTAYKNYDYSEPGRNNEQPGLCGLSNLGNTCFMN
SAIQCLSNTPPLTEYFLNDKYQEELNFDNPLGMRGEIAKSYAELIKQMWSGKFSYVTPRA
FKTQVGRFAPQFSGYQQQDCQELLAFLLDGLHEDLNRIRKKPYIQLKDADGRPDKIVAEE
AWENHLKRNDSIIVDIFHGLFKSTLVCPECAKISVTFDPFCYLTLPLPMKKERTLEVYLV
RMDPLTKPMQYKVVVPKIGNILDLCTALSALSGVPADKMIVTDIYNHRFHRIFAMDENLS
SIMERDDIYVFEININRTEDTEHVIIPVCLREKFRHSSYTHHTGSSLFGQPFLMAVPRNN
TEDKLYNLLLLRMCRYVKISTEAEETEGSLHCCKDQNINGNGPNGIHEEGSPSEMETDEP
DDESSQDQELPSENENSQSEDSVGGDNDSENGLCTEETCKGQLTGHKKRLFTFQFNNLGN
TDINYIKDDTRHIRFDERQLRLDERSFLALDWDPDLKKRYFDENAAEDFEKHESVEYKPP
KKPFVKLKDCIELFTTKEKLGAEDPWYCPNCKEHQQATKKLDLWSLPPVLVVHLKRFSYS
RYMRDKLDTLVDFPINDLDMSEFLINPNAGPCRYNLIAVSNHYGGMGGGHYTAFAKNKDD
GKWYYFDDSSVSTASEDQIVSKAAYVLFYQRQDTFSGTGFFPLDRETKGASAATGIPLES
DEDSNDNDNDIENENCMHTN
NT seq 2583 nt NT seq  +upstreamnt  +downstreamnt
atgtttgtaaagcactgcaaagtagaagtatatctcacagaattgaagctctgtgaaaat
ggaaacatgaataatgttgtaactcgaagatttagtaaagctgacacaatagatacaatt
gaaaaggaaataagaaaaatcttcaatattccagatgaaaaggagaccagattgtggaac
aaatacatgagtaatacatttgaaccactgaataagccagacagcaccattcaggatgct
ggtttataccaaggacaggtgttagtgatagaacagaaaaatgaagatggaacatggcca
aggggtccttctgctcctaagtccccaggtgcatccaatttttcagctttaccaaagatc
tctccttcatctctatcaaataattataacaacatcaacaacagaaatgtgaaaaactca
aattattgtctcccatcatatactgcttataagaactatgattattcagaacctggcaga
aacaatgaacagccaggcctctgtggcctaagtaacttgggaaatacgtgtttcatgaac
tcagctattcagtgtttgagcaacacacctccacttactgaatacttcctcaatgataag
tatcaagaagaactgaattttgacaatcccttaggaatgagaggtgaaatagctaaatct
tatgctgaattgatcaaacaaatgtggtctggaaaatttagctatgtcacgccaagagcc
tttaagacccaagtaggacgttttgcacctcagttttctggataccagcagcaagactgt
caagagcttttagctttcctattagatggattacatgaagatttgaatagaattaggaaa
aaaccgtatatacaattaaaagatgcagatggaaggccagataagatagttgctgaagaa
gcctgggaaaaccatttaaaaagaaatgattctatcatagtagatatatttcacggcctt
ttcaaatcaactttagtttgtcctgaatgtgctaagatttcagtaacatttgatcctttt
tgttacttgacacttccattgcccatgaaaaaagaacgtaccttggaagtatatttagtc
agaatggatccacttaccaaacctatgcagtacaaagtggttgtccccaaaattggaaac
atacttgatctttgtacagcattgtctgctttgtcaggagtacctgcagataagatgata
gttactgatatatacaatcatagatttcacagaatattcgctatggatgaaaaccttagt
agtattatggaacgggacgatatttatgtgtttgaaattaacatcaataggacagaagat
acagaacatgtgattattcctgtttgcctaagagaaaaatttagacactcaagttatacc
caccatactggttcttcactttttggccagccttttcttatggctgtaccacgaaataat
actgaagataagctctataatctcctgcttttgagaatgtgccgatatgtcaaaatttct
actgaagctgaagaaactgaaggatccctacactgctgtaaggaccaaaatattaatggg
aatggcccaaatggcatacatgaagaaggctcaccaagtgaaatggaaacagatgagcca
gatgatgaatccagccaggatcaagaacttccctccgaaaatgaaaacagtcagtctgag
gattcagttggaggagataatgattctgaaaatggattatgtactgaggaaacttgcaaa
ggtcaactcacgggacacaaaaaaagattgtttacattccagttcaacaatttaggcaat
actgatattaactacatcaaagatgataccaggcatataagatttgatgagaggcagctt
aggctagatgaaagatcatttcttgctttggattgggatcctgatttgaaaaaaagatat
tttgatgaaaatgccgcagaggattttgaaaaacatgaaagtgtggaatataaacctcct
aaaaaaccctttgtgaaattaaaagattgcattgaactttttacaacaaaagaaaagcta
ggtgctgaagatccttggtattgtccaaattgtaaagaacatcagcaagccacaaagaaa
ttggatttatggtccctgcctccagtacttgtggtacatctcaagcggttttcttacagt
cgatacatgagagacaaattggataccttagttgattttcccatcaatgacctggatatg
tcggaattcttaattaatccaaatgcaggtccttgccgctataatttgattgctgtttcc
aaccactatggaggaatgggaggaggacactatactgctttcgcaaaaaacaaagatgat
ggaaaatggtactactttgatgacagtagtgtctcaactgcatctgaagaccagattgtg
tccaaagcagcatatgtacttttctaccagagacaagacactttcagtggaactggcttt
tttcctcttgaccgagaaactaaaggtgcttcagctgccacaggcatcccattagaaagt
gatgaagatagcaatgataatgacaatgatatagaaaacgaaaactgtatgcacactaac
taa

DBGET integrated database retrieval system