KEGG   Canis familiaris (dog): 474534Help
Entry
474534            CDS       T01007                                 

Gene name
ALDH1L2
Definition
aldehyde dehydrogenase 1 family, member L2
Orthology
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
cfa  Canis familiaris (dog)
Pathway
One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    474534 (ALDH1L2)
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.6  formyltetrahydrofolate dehydrogenase
     474534 (ALDH1L2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
10
AA seq 923 aa AA seqDB search
MLWRGSQALRRFSTGQAYFKNKLKLALIGQSLFGQEVYSHLCKEGHRVVGVFTVPDKDGK
ADPLALAAEKDGTPVFKFPRWRVKGKTIKEVAEAYKSVGAELNVLPFCTQFIPMDVIDSP
KHGSIIYHPSILPRHRGASAINWTLIMGDKKAGLSVFWADDGLDTGPILLQRSCDVEPND
TVDALYNRFLFPEGIKAMVEAVQLIADGKAPRIPQPEEGATYEGIQKKENAEISWDQSAE
VLHNWIRGHDKVPGAWTEINGQMVTFYGSSLLKSSVPPGEPLEIKGAKKPGLVTKNGLVL
FGNDGKALMVRNLQFEDGRMIPASQYFSAGETSVVELTAEEVKVAGTIKVIWAGILSNVP
VIEDSTDFFKSGASSMDVVRLVEEIRQRCGGLQLQNEDVYMATKFEDFIQKVVRKLRGED
QEVELVVDYVSKEVNEMTVKMPYQCFINGQFTDANDGKTYDTINPTDGSTICKVSYASLV
DVDKAVAAAKDAFEKGEWGRMNARERGRLMYRLADLLEENQEELATIEALDSGAVYTLAL
KTHIGMSVQTFRYFAGWCDKIQGSTIPINQARPNRNLTFTKKEPLGVCAIIIPWNYPLMM
LAWKSAACLAAGNTLVLKPAQVTPLTALKFAELSSKAGFPKGVINIIPGSGGVAGQRLSE
HPHIRKLGFTGSTAIGKQIMKSCAVSNLKKVSLELGGKSPLIIFNDCELDKAVRMGMGAV
FFNKGENCIAAGRLFVEESIHDEFVTKVVEEIKKMKIGDPLDRSTDHGPQNHQAHLEKLL
QYCEAGVKEGATLVYGGRQVCRPGFFMEPTVFTDVEDHMYLAKEESFGPIMVISKFQNGD
IDGVLQRANNTEYGLASGVFTRDINKAMYVSEKLEAGTVFVNTYNKTDVAAPFGGVKQSG
FGKDLGEEALNEYLKTKTVTLEY
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atgctgtggcgcggcagccaggcgctccggcgcttctccaccggccaggcttatttcaaa
aacaagctgaagttggcacttattggtcagagcctctttggccaggaagtctacagtcac
ctctgcaaagagggccaccgagttgtgggtgtgttcacggttccagacaaggatggaaaa
gccgacccgctggctctagctgcagagaaagatgggacacctgtgttcaagttccccaga
tggagagtcaagggcaagaccataaaggaggtggcggaggcctacaaatctgtgggtgct
gagctaaacgtgcttcctttctgcacacagtttatccctatggatgtaattgacagccca
aagcacggttccatcatatatcacccttccatcctcccccggcacagaggagcctctgct
atcaactggactctaattatgggagacaagaaagctgggttgtctgttttctgggctgat
gatggtttagacactggacccatccttcttcagaggtcatgtgacgttgaacccaatgat
acagtggatgcactttataatcggtttctttttcctgaaggaatcaaggccatggtggaa
gctgtccaactcatagccgatggaaaagctcctcgtattccccagccagaagaaggggca
acgtatgaaggtatccagaaaaaggaaaatgctgagatttcttgggatcagtctgccgaa
gttttacataactggatccgaggtcatgataaagttcctggagcttggacagagataaac
ggacagatggtcacgttctatggctcatcattactgaaaagctctgtgcctcctggagaa
ccactggaaattaaaggtgccaagaagcctggtcttgttaccaaaaatggacttgttctt
tttggtaatgatggaaaagcactgatggtgagaaatctgcagtttgaagatggaagaatg
attcctgcttctcagtacttttcagccggtgagacatcagtggtagaacttacagccgaa
gaggtcaaggtggcagggaccatcaaggtcatctgggctggaattttaagcaatgtccct
gttattgaagactcaacagacttctttaaatctggagcgagctcaatggatgttgtcagg
ctggttgaggagatcagacagaggtgtggtgggcttcagctgcagaacgaagatgtctat
atggccaccaagttcgaagacttcatccaaaaagtcgtgaggaaattgagaggagaagat
caagaagtggaactagtggtggattatgtttcaaaggaggtcaatgaaatgaccgtgaaa
atgccatatcaatgtttcataaatggacagttcacagatgctaatgatggaaagacctat
gatactatcaacccaacagatggatctacaatatgcaaagtatcctatgcttctttggtg
gatgttgataaagcagtagcagcagcaaaagatgcctttgaaaaaggtgaatggggaaga
atgaatgcaagagaaagaggaagattgatgtacagacttgcagacctcctggaagaaaac
caggaagaactggcaaccattgaagcccttgattcaggcgctgtctataccctggctctg
aagactcacatcggaatgtctgtgcaaacattcagatattttgctggctggtgtgacaaa
attcagggctctaccattccaatcaaccaagcccgtccaaatcgcaatctgaccttcacc
aagaaggagccacttggtgtctgtgccattatcatcccctggaattacccactgatgatg
ctggcatggaagagcgctgcgtgtttggcagcaggcaataccttagtgctcaagccagca
caggtcacacccttgactgctttgaagtttgctgagctctcttcgaaagcaggctttcca
aagggtgtaatcaacatcattccaggctcaggtggtgtagccgggcaacgcctttctgaa
catcctcatatccgcaaacttggcttcactgggtccactgctatcggcaaacagatcatg
aagagctgtgctgtgagcaacttgaagaaagtttcccttgaacttggtggcaaatcccca
cttataatattcaacgactgtgaacttgacaaggctgtgcgaatgggcatgggggcagta
tttttcaacaaaggagagaattgtattgcagctgggcgtttgtttgtggaagaatccatc
cacgatgaatttgtgacaaaagtggtagaagaaattaaaaagatgaaaattggtgatcca
cttgacagatctacagatcacgggccccaaaaccatcaggcccatctggaaaagcttctg
caatactgtgaagctggagtgaaggaaggggccaccttggtgtatgggggaagacaagtg
tgcaggccaggcttttttatggagccaactgtgttcacagatgtggaagaccacatgtat
cttgccaaagaggaatcatttgggcctattatggtcatttctaagttccaaaatggggac
atcgatggagtgttacagcgagcaaataatacagagtatggtctggcctcaggggttttt
acaagagacatcaataaagccatgtatgtgagcgaaaaactcgaagcaggaactgttttt
gttaacacgtacaacaagacggatgtggcagcccctttcggtggagttaaacaatcgggc
ttcggaaaagacttaggtgaggaagctctaaacgaatacctcaaaaccaagacggtgaca
ttggaatactag

DBGET integrated database retrieval system