KEGG   Canis familiaris (dog): 474652Help
Entry
474652            CDS       T01007                                 

Gene name
MAPK9
Definition
(RefSeq) mitogen-activated protein kinase 9
  KO
K04440  c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa01522  Endocrine resistance
cfa04010  MAPK signaling pathway
cfa04012  ErbB signaling pathway
cfa04014  Ras signaling pathway
cfa04024  cAMP signaling pathway
cfa04068  FoxO signaling pathway
cfa04071  Sphingolipid signaling pathway
cfa04137  Mitophagy - animal
cfa04140  Autophagy - animal
cfa04141  Protein processing in endoplasmic reticulum
cfa04210  Apoptosis
cfa04215  Apoptosis - multiple species
cfa04217  Necroptosis
cfa04310  Wnt signaling pathway
cfa04380  Osteoclast differentiation
cfa04510  Focal adhesion
cfa04530  Tight junction
cfa04620  Toll-like receptor signaling pathway
cfa04621  NOD-like receptor signaling pathway
cfa04622  RIG-I-like receptor signaling pathway
cfa04625  C-type lectin receptor signaling pathway
cfa04657  IL-17 signaling pathway
cfa04658  Th1 and Th2 cell differentiation
cfa04659  Th17 cell differentiation
cfa04664  Fc epsilon RI signaling pathway
cfa04668  TNF signaling pathway
cfa04722  Neurotrophin signaling pathway
cfa04723  Retrograde endocannabinoid signaling
cfa04728  Dopaminergic synapse
cfa04750  Inflammatory mediator regulation of TRP channels
cfa04910  Insulin signaling pathway
cfa04912  GnRH signaling pathway
cfa04914  Progesterone-mediated oocyte maturation
cfa04917  Prolactin signaling pathway
cfa04920  Adipocytokine signaling pathway
cfa04926  Relaxin signaling pathway
cfa04930  Type II diabetes mellitus
cfa04931  Insulin resistance
cfa04932  Non-alcoholic fatty liver disease (NAFLD)
cfa04933  AGE-RAGE signaling pathway in diabetic complications
cfa05132  Salmonella infection
cfa05133  Pertussis
cfa05142  Chagas disease (American trypanosomiasis)
cfa05145  Toxoplasmosis
cfa05152  Tuberculosis
cfa05160  Hepatitis C
cfa05161  Hepatitis B
cfa05164  Influenza A
cfa05167  Kaposi's sarcoma-associated herpesvirus infection
cfa05168  Herpes simplex infection
cfa05169  Epstein-Barr virus infection
cfa05200  Pathways in cancer
cfa05210  Colorectal cancer
cfa05212  Pancreatic cancer
cfa05231  Choline metabolism in cancer
cfa05418  Fluid shear stress and atherosclerosis
Module
cfa_M00688  MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    474652 (MAPK9)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    474652 (MAPK9)
   04010 MAPK signaling pathway
    474652 (MAPK9)
   04012 ErbB signaling pathway
    474652 (MAPK9)
   04310 Wnt signaling pathway
    474652 (MAPK9)
   04668 TNF signaling pathway
    474652 (MAPK9)
   04068 FoxO signaling pathway
    474652 (MAPK9)
   04071 Sphingolipid signaling pathway
    474652 (MAPK9)
   04024 cAMP signaling pathway
    474652 (MAPK9)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    474652 (MAPK9)
   04137 Mitophagy - animal
    474652 (MAPK9)
  Cell growth and death
   04210 Apoptosis
    474652 (MAPK9)
   04215 Apoptosis - multiple species
    474652 (MAPK9)
   04217 Necroptosis
    474652 (MAPK9)
  Cellular community - eukaryotes
   04510 Focal adhesion
    474652 (MAPK9)
   04530 Tight junction
    474652 (MAPK9)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    474652 (MAPK9)
   04621 NOD-like receptor signaling pathway
    474652 (MAPK9)
   04622 RIG-I-like receptor signaling pathway
    474652 (MAPK9)
   04625 C-type lectin receptor signaling pathway
    474652 (MAPK9)
   04658 Th1 and Th2 cell differentiation
    474652 (MAPK9)
   04659 Th17 cell differentiation
    474652 (MAPK9)
   04657 IL-17 signaling pathway
    474652 (MAPK9)
   04664 Fc epsilon RI signaling pathway
    474652 (MAPK9)
  Endocrine system
   04910 Insulin signaling pathway
    474652 (MAPK9)
   04920 Adipocytokine signaling pathway
    474652 (MAPK9)
   04912 GnRH signaling pathway
    474652 (MAPK9)
   04914 Progesterone-mediated oocyte maturation
    474652 (MAPK9)
   04917 Prolactin signaling pathway
    474652 (MAPK9)
   04926 Relaxin signaling pathway
    474652 (MAPK9)
  Nervous system
   04728 Dopaminergic synapse
    474652 (MAPK9)
   04723 Retrograde endocannabinoid signaling
    474652 (MAPK9)
   04722 Neurotrophin signaling pathway
    474652 (MAPK9)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    474652 (MAPK9)
  Development
   04380 Osteoclast differentiation
    474652 (MAPK9)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    474652 (MAPK9)
   05231 Choline metabolism in cancer
    474652 (MAPK9)
   05210 Colorectal cancer
    474652 (MAPK9)
   05212 Pancreatic cancer
    474652 (MAPK9)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    474652 (MAPK9)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    474652 (MAPK9)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    474652 (MAPK9)
   04931 Insulin resistance
    474652 (MAPK9)
   04933 AGE-RAGE signaling pathway in diabetic complications
    474652 (MAPK9)
  Infectious diseases
   05132 Salmonella infection
    474652 (MAPK9)
   05133 Pertussis
    474652 (MAPK9)
   05152 Tuberculosis
    474652 (MAPK9)
   05164 Influenza A
    474652 (MAPK9)
   05161 Hepatitis B
    474652 (MAPK9)
   05160 Hepatitis C
    474652 (MAPK9)
   05168 Herpes simplex infection
    474652 (MAPK9)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    474652 (MAPK9)
   05169 Epstein-Barr virus infection
    474652 (MAPK9)
   05145 Toxoplasmosis
    474652 (MAPK9)
   05142 Chagas disease (American trypanosomiasis)
    474652 (MAPK9)
  Drug resistance
   01522 Endocrine resistance
    474652 (MAPK9)
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     474652 (MAPK9)
Protein kinases [BR:cfa01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   474652 (MAPK9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH RIO1 Kinase-like FTA2 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 474652
NCBI-ProteinID: XP_005626346
Ensembl: ENSCAFG00000000395
Position
11
AA seq 382 aa AA seqDB search
MSDSKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQ
LGTPSADFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSK
MLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
LDWEERSKNGVVKDQPSAQMQQ
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacagtaaatgtgacagtcagttttacagtgtgcaagtggcagactcaactttc
actgtcttaaaacgttatcagcagttgaaaccaattggctctggagcccaaggaattgtt
tgtgccgcttttgatacagttcttgggataaatgttgcagtcaagaaactgagtcgtcct
tttcagaatcagactcatgcaaagagagcttaccgtgaactcgtcctcttaaaatgtgtc
aatcataaaaatataattagtttgttaaatgtgtttacaccacaaaagactctagaagaa
tttcaagatgtgtatttggttatggagctaatggatgctaacttatgtcaggttattcac
atggagttagaccatgaaagaatgtcctaccttctttaccagatgctctgtggtattaaa
catctgcattcagctggtataattcatagagatttgaaacctagcaacatcgtagtaaaa
tcagactgcacgcttaagatccttgactttggcctggcccggacggcatgcaccaacttc
atgatgacaccgtacgtggtgacgcgctattaccgggcacctgaagtcatcctgggcatg
ggctacaaagagaatgttgatatctggtcagtgggttgcatcatgggagagctggtgaaa
ggttgtgtgatattccaaggcactgatcatattgatcagtggaataaagtcattgagcag
ctgggaacgccgtctgcggattttatgaagaaactccagccaaccgtgaggaattatgta
gaaaacagaccgaaataccctggaatcaaatttgaagagctcttcccagattggatattc
ccatcagaatccgaacgagacaaaattaaaacgagtcaagccagagatttgttgtcaaaa
atgttagtgatagatcctgacaagcggatctctgtagatgaagctttacgtcacccttac
attactgtttggtatgaccctgctgaagctgaagcgccaccacctcagatttacgatgcc
cagttggaagaaagagagcatgcaattgaagagtggaaagaactgatttataaagaagtg
ctggattgggaagaaagaagcaagaatggtgttgtgaaagatcagccttcagcacagatg
cagcagtaa

DBGET integrated database retrieval system