KEGG   Canis familiaris (dog): 474760Help
Entry
474760            CDS       T01007                                 

Gene name
GBA2
Definition
glucosidase, beta (bile acid) 2
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
cfa  Canis familiaris (dog)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    474760 (GBA2)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    474760 (GBA2)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     474760 (GBA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
11
AA seq 917 aa AA seqDB search
MGTGVPASEQTRCAKGDPQVDCPEDAGDTEAGQVTDFESPEDKRPQSEPGYSNPEDSGQL
MASYEGKAKGYQVPPFGWRICLAHEFAEKRKPFNANNVSLSNLIKHLGMGLRYLQWWYRK
TQVEKKTPFIDLINCVPLRQIYGCPLGGIGGGTITRGWRGQFCRWQLNPGMYQHRTVIAD
QFTVCLRREGKTVYQQVLSVERPSVLRSWNWGLCGYFAFYHALYPRAWTVYQLPGQNVTL
TCRQITPILPHDYQDSSLPVGVFVWDVENEGDEALDVSIMFSMRNGLGGGDDAIGGLWNE
PFCLERDGETVQGLLLHHPALPNPYTMAVAARLTADTTVTHITAFDPDSTGQQVWQDLLQ
DGQLDSPAGRSTPSQKGAGIAGAVCVTGKLPPRGQCRLEFSLAWDMPRIMFGAKGQVYYR
RYTRFFGRDGNAAPALSHYALCQYVDWEEKISAWQSPVLDDRSLPAWYKSALFNELYFLA
DGGTVWLEVPEDSLPEKLVESMCQLRPILREYGRFGYLEGQEYRMYNTYDVHFYASFALV
MLWPKLELSLQYDMAVATLREDLTRRQYLMSGVMAPVKRRNVIPHDIGDPDDEPWLRVNA
YVVHDTADWKDLNLKFVLQVYRDYYLTGDQGFLRDMWPVCLAVMESEMKFDKDQDGLIEN
GGYADQTYDGWVTTGPSAYCGGLWLAAVAVMVQMAILCGAHDVQDKFSSILRRGQEAYER
LLWNGRYYNYDCSPQPQSCSIMSDQCAGQWFLRASGLGEGDTEVFPTRHVVCALQTIFEF
NVRAFAGGAMGAVNGMQPHGVPDRSSVQSDEVWVGVVYGLAATMIQEGLTWEGFQTAEGC
YRTVWERLGLAFQTPEAYCQQRVFRSLAYMRPLSIWAMQLALQQQQQKKASRPVAAHGTE
LSTGPKLGPKEAMANPK
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgggaactggagtcccagcctcggagcagacgaggtgtgccaaaggggatccacaggtt
gattgccctgaagatgctggagacactgaggctgggcaggttacagacttcgagagccct
gaggacaagcgaccccaaagtgaaccgggctacagcaatccagaggactctgggcaactg
atggcttcttatgaaggtaaagcgaagggctaccaggtgcctccctttggctggcgcatc
tgcctggctcatgagtttgcagagaagaggaaaccctttaatgccaacaacgtttcccta
agcaacctgataaagcatctgggcatgggcttgcggtacttgcagtggtggtaccggaaa
acccaggtagagaagaagacacctttcatcgacctcatcaattgtgtacctctgagacag
atctatggttgtcctttgggtggcatcgggggaggcactatcacccgaggctggagaggc
caattctgtcgttggcagcttaatcctggaatgtaccagcaccggacagtcatcgctgac
cagttcacagtgtgcttgcgtcgggagggaaagactgtgtaccagcaagtcctgtccgtg
gagcgcccaagtgtcctacgcagctggaactggggcctgtgtgggtactttgcattctac
cacgccctctatccccgagcctggactgtctatcagcttcctggccagaatgtcaccctc
acctgtcgccagatcacacccatcttaccccatgactaccaggacagcagcctgcctgta
ggagtctttgtgtgggatgtggaaaatgaaggggatgaagccctggatgtgtccatcatg
ttctccatgcggaatggactagggggtggggatgacgccatagggggattgtggaatgag
cccttctgtctggagcgtgatggagagacggtgcaggggctgctgctccatcatccagcc
cttccgaatccctacacgatggccgtggctgcacgactcacggcggataccacggtaacc
catatcacagcctttgaccctgacagcactgggcagcaggtgtggcaagatctgcttcaa
gatggacagctggactcccctgctggtcgaagcaccccctcacagaaaggagcaggcatc
gctggggctgtgtgtgttacaggaaagctgccacctcgaggccagtgccgcctggagttc
tcactggcttgggatatgcccagaatcatgtttggagctaagggccaggtctactacagg
cggtacacgaggttctttggccgcgatggtaatgcagcacctgctcttagccactatgct
ctatgccagtacgtagactgggaagagaagatctcagcttggcagagcccagtattggac
gacagatccttgcctgcctggtacaaatctgcactgttcaatgaactatacttcctggct
gatggaggcacagtatggctggaagttcccgaggactccctaccagagaagctggtggag
agcatgtgtcagctccgccccatcctccgggaatatggtcgatttggctaccttgaaggc
caggaatatcgcatgtacaacacatatgatgtccacttttacgcttcctttgccctcgtc
atgctctggcccaaactcgagctcagcctgcagtatgatatggctgtggccacactcagg
gaggacctgacacggcgacaatacctgatgagtggggtaatggcacctgtgaaaaggagg
aacgtcatcccccatgatattggggacccagatgacgagccatggctccgagtcaatgcg
tacgtggtccacgatacagctgactggaaggacctaaatctgaagtttgtgctgcaggtt
tatcgagactattacctgacgggtgaccagggcttcctgagagacatgtggcctgtgtgt
ctggctgtgatggagtctgaaatgaagtttgacaaggaccaagatggactcattgagaac
ggaggctatgcagaccagacctatgatggatgggtcactacaggccccagtgcttactgt
ggaggactgtggctggcagctgtggctgtgatggtccagatggctattctgtgtggggca
cacgatgtccaagataagttttcttccatccttagacggggccaagaagcctatgagaga
ctgttgtggaatggccgctactacaactatgattgcagccctcagccccagtcctgtagc
atcatgtctgaccagtgtgcgggccaatggttcctgagggccagtggtctaggagaagga
gacactgaggtatttcctacccgacatgtggtctgtgctctccaaactatctttgagttc
aacgtccgggcctttgcaggaggagcaatgggggctgtgaatgggatgcagccccatggt
gtccctgacagatccagcgtccagtctgatgaagtctgggtgggtgtggtctatggactg
gcagctaccatgatccaggagggcctgacttgggaaggcttccagacagctgaaggctgc
taccgaactgtgtgggagcgcctgggcctggccttccagacccctgaagcatactgccag
cagcgggtgttccgctcattggcctacatgcggccactgagcatctgggccatgcagctg
gccctgcaacagcagcagcagaaaaaggcctccaggccagtagccgcacatggcacagaa
ctaagcacagggcctaaacttggaccaaaggaagctatggcaaacccaaagtga

DBGET integrated database retrieval system