KEGG   Canis familiaris (dog): 474823Help
Entry
474823            CDS       T01007                                 

Gene name
ARG1
Definition
arginase 1
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
cfa  Canis familiaris (dog)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Amoebiasis
Module
Urea cycle
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    474823 (ARG1)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    474823 (ARG1)
 Human Diseases
  Infectious diseases
   05146 Amoebiasis
    474823 (ARG1)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     474823 (ARG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
12
AA seq 330 aa AA seqDB search
MSSTAKSIGIIGAPFSKGQPRGGVEKGPTALRKAGLLEKLKEQVSKNFLIIDCDVKDYGD
VPFVDVPSDPPFQIVKNPRSVGKANEQLAGVVAEVKKNGRTSLVLGGDHSMAIGSISGHA
RVHPDLCVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCLSAK
DIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDKLGIGKVMEEALSYLLGRKKRPIHLSFD
VDGLDPSFTPATGTPVTGGLSYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEITRT
VNTAVAITLACFGVAREGNHKPIDYLNPPK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgagttccacggcaaaatccattgggatcatcggagcgcctttctcaaagggccagcca
cgaggaggggtggaaaaaggccccacagcactgaggaaggctggcctgctggagaaactt
aaggaacaagtaagtaagaatttcttaattatagactgtgatgtgaaagattatggggac
gtgccctttgttgatgtccctagtgatcctccctttcaaattgtgaagaatccaaggtct
gtgggcaaggcgaatgagcagctggctggtgtggtggcagaagtcaagaagaacggaagg
actagcctggtgctgggtggagaccacagcatggctattggaagcatctctggccatgcc
agggtccacccagatctctgtgtcatttgggtggatgctcacactgatatcaacactcca
ctgacaaccacaagtgggaacttgcacggacaacctgtgtctttcctcctgaaggaacta
aaaggaaagatacccgatgtaccaggattctcttgggtgactccttgcctatctgccaaa
gatattgtgtatattggcctaagagatgtggaccctggggaacactacattttgaaaact
ctgggtattaaatatttttcaatgactgaagtggataaactgggaattggcaaggtgatg
gaagaagcactcagctatctactaggaagaaaaaaaagaccaattcatctgagctttgat
gttgatggattggacccatccttcacaccagctacgggcacaccagtcacgggaggtctg
tcttacagagaaggtctctacattacagaagaaatttacaaaacagggctactctcagga
ttagatataatggaagtgaacccatctctggggaagacaccagaagaaataactcgaaca
gtgaacacagcagtagcaataaccctggcttgcttcggagttgctcgggagggtaatcat
aagcctattgactaccttaacccacctaagtaa

DBGET integrated database retrieval system