KEGG   Canis familiaris (dog): 474899Help
Entry
474899            CDS       T01007                                 

Gene name
USP49
Definition
ubiquitin specific peptidase 49
Orthology
K11834  
ubiquitin carboxyl-terminal hydrolase 44/49 [EC:3.1.2.15]
Organism
cfa  Canis familiaris (dog)
Brite
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     474899 (USP49)
Peptidases [BR:cfa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   474899 (USP49)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
12
AA seq 601 aa AA seqDB search
MDRCKHVGRLRLAQDHSILNPQKWCCRECATTESVWACLKCSHVACGRYIEDHALKHFEE
TGHPLAMEVRDLYVFCYLCKDYVLNDNPEGDLKLLRSSLLAVRGQKQDPPLRRGRTLRSM
ASGEDAVLPQRAPQGQPQMLTALWYRRQRLLAKTLRLWFEKSSRGQAKLEQRRREEALER
KKEAARQRRREVKRRLLEELASAPPRKSARLLLHAPRAAAPRPAAPRAPAGGRPPPRRAP
AMAPGVTGLRNLGNTCYMNSILQVLSHLQKFRECFLYLDPSQTQQLFPKAPNGKAPLSGR
PAASAAELSARSGGAEACEREGLCFNGGASISRSLELIQNKEPSSKHISLCHELHTLFRV
MWSGKWALVSPFAMLHSVWSLIPAFRGYDQQDAQEFLCELLHKVQQELESEGTTRRILIP
FSQRKLTKQVLKVVNTIFHGQLLSQVTCISCNYKSNTIEPFWDLSLEFPERYHCIEKGFV
PLNQTECLLTEMLAKFTETEALEGRIYACDQCNSKRRKSNPKPLVLSEARKQLMIYRLPQ
VLRLHLKRFRWSGRNHREKIGVHVVFDQWSCITGKGLAQDTTQPIATTQREVFGSTAMTQ
S
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atggatagatgcaaacatgtcgggcggttgcggctcgcccaggaccactccatcctgaac
ccgcagaagtggtgctgcagggagtgcgccaccaccgagtccgtgtgggcttgtctcaag
tgctcccacgtggcctgcggccgctacatcgaggatcacgccctgaaacacttcgaggag
actgggcacccgctggccatggaggtccgggacctgtacgtgttctgttacctgtgcaag
gactacgtgctcaacgataacccggagggggacctgaagctgctcaggagctccctcctg
gcggtcaggggccagaagcaggacccgccgctgaggcgcgggcggacgctgcggtccatg
gcctcgggcgaggacgccgtcctgccgcagcgcgctcctcagggacagccgcagatgctc
acggctctgtggtaccggcgccagcgcctgctggccaagacgctgcggctgtggttcgag
aagagctcccgcggccaggcgaagctggagcagcggcggcgggaggaggcgctggagcgg
aagaaggaggcggcgcggcagcggcggcgcgaggtgaagcggcggctgctggaggagctg
gccagcgcccctccgcgcaaaagcgcgcgcctgctgctgcacgcgccccgcgccgccgcc
ccgcgccccgccgccccgcgcgcgcccgccgggggccgcccgccgccgcgccgcgctccc
gccatggcgccgggcgtcacgggcctgcgcaacctgggcaacacctgctacatgaactcc
atcctgcaggtgctcagccacctccagaagttccgcgagtgttttctgtacctcgaccct
tcccagacccagcagctgttccccaaggcccccaacgggaaggccccgctctcgggcagg
ccggccgcctcggccgcggagctgtcggccaggagcggcggggccgaggcgtgcgagcgc
gagggcctctgcttcaacggcggggcctccatcagcaggagcctagaactcatacagaac
aaggagccgagctcgaagcacatttccctctgtcacgaactgcacaccctcttccgagtc
atgtggtccgggaagtgggccctggtgtcccccttcgccatgcttcactccgtgtggagc
ctgatccccgccttccgtggctacgaccagcaggacgcgcaggaattcctctgcgagctg
ttgcacaaagtgcagcaagagctcgagtctgagggcaccacgcgccggatcctcatcccc
ttctcccagaggaagctcaccaaacaggtcttaaaggtagtgaacaccatattccacggg
cagctactcagtcaggtcacatgtatatcatgcaattacaaatccaataccattgagccc
ttttgggatctgtccctggaattccctgaacggtatcactgcatagaaaaggggtttgtc
cctttgaatcagacagagtgcctgctcactgagatgctggctaagttcacagagacagag
gctctggaagggagaatctacgcttgtgaccagtgtaacagcaaacgacgaaaatccaat
cccaaaccccttgttctgagtgaagctagaaagcagttaatgatctacagactacctcag
gtcctccggctgcaccttaaaagattcaggtggtctggccgtaatcatcgagagaagatt
ggggtccatgtcgtctttgaccagtggtcatgcatcacgggaaagggtttggctcaggac
actacacagcctattgctacaacacagagggaggtttttgggtccactgcaatgactcaa
agctga

DBGET integrated database retrieval system