KEGG   Canis familiaris (dog): 475145Help
Entry
475145            CDS       T01007                                 

Gene name
CLOCK
Definition
clock circadian regulator
Orthology
K02223  
circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
cfa  Canis familiaris (dog)
Pathway
Circadian rhythm
Dopaminergic synapse
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    475145 (CLOCK)
  Environmental adaptation
   04710 Circadian rhythm
    475145 (CLOCK)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    475145 (CLOCK)
Enzymes [BR:cfa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     475145 (CLOCK)
Transcription factors [BR:cfa03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    475145 (CLOCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
13
AA seq 847 aa AA seqDB search
MLFTVSCSKMSSIVDREDGSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSM
LPGNARKMDKSTVLQKSIDFLRKHKEITAQSDASEIRQDWKPTFLSNEEFTQLMLEALDG
FFLAIMTDGSIIYVSESITSLLEHLPSDLVDQSIFNFIPEGEHSEVYKMLSTHLLESDSL
TPEYLKSKNQLEFCCHMLRGTIDPKEPSTYEYVKFIGNFKSLNSVSTSAHNGFEGTIQRT
HRPSYDDRVCFVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYL
PFEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYH
QWNSRPEFIVCTHTVVSYAEVRAERRRELGIEESLPETAADKSQDSGSDNRINTVSLKEA
LERFDHSPTPSASSRSSRKSSHTAVSDPSSTPTKIPTDTSTPPRPHLPSHEKMAPRRASF
SSQSINSQSVGQSLTQPAMSQAANLPIPQGMSQFQFSAQLGAMQHLKDQLEQRTRMIEAN
IHRQQEELRKIQEQLQMVHGQGLQMFLQQSTPGLNFGSVQLSSGNSSNIQQLAPINMQGQ
VVQTNQIQSGMNTGHIGTTQHMIPQQTLQSTSSQQSQQNVLSGHSQQTSLPSQTQSTLTA
PLYNTMVISQPAAGGMVQIPSSMPQNSTQSAAVTTFTQDRQIRFSQGQQLVTKLVTAPVA
CGAVMVPSTMLMGQVVTAYPTFATQQQQSQTLSVTQQQQQQSSQEQQLASVQQPSQAQLT
QPPQQFLQTSRLLHGNPSTQLILSAAFPLQQSTFPQSHHQQHQSQQQQQLSRHRTDSVTD
PSKVPPQ
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
atgttgtttaccgtaagctgtagtaaaatgagctcgattgttgacagagaagatggtagt
atttttgatgggttggtggaagaagatgacaaggacaaagcaaaaagagtatctagaaac
aaatctgaaaagaaacgtagagatcaatttaatgttctcattaaagaactgggatccatg
cttcctggtaatgctaggaagatggacaaatctactgttctgcagaagagcattgatttt
ttacgaaaacataaagaaatcactgcacagtcagatgccagtgaaatccgacaggactgg
aaacctacattccttagtaatgaagaatttacacaattaatgttagaggctcttgatggt
ttttttttagcaatcatgacagatggaagcataatatatgtgtctgagagtataacttca
ttacttgaacatttaccatctgatcttgtggatcaaagcatatttaattttatcccagaa
ggggaacattcagaagtttataaaatgctctctactcatctgctggaaagtgattcctta
acccctgaatatttaaaatcaaaaaatcaattagaattctgttgtcatatgcttcgagga
acaatagacccaaaggagccatctacctatgaatatgtgaaatttataggaaattttaaa
tccttaaacagtgtatccacttcagcacacaatggttttgaaggaactatacaacgcaca
cacaggccatcttacgatgatagagtttgttttgtagctactgtgagattagctacacct
cagttcatcaaggaaatgtgcactgttgaagaacctaatgaagagtttacatctagacat
agtttagaatggaagttcctatttctagatcacagggcaccacctataataggatatttg
ccatttgaagttctgggaacatcaggctatgattactatcatgtggatgacctagaaaat
ttggcaaagtgtcatgagcacttaatgcaatatgggaaaggcaaatcatgttattatagg
ttcctcaccaagggacagcagtggatttggcttcaaactcattattacatcacttatcat
cagtggaattcaaggccagagtttattgtttgtactcacaccgtagtaagttatgcagaa
gttagggctgaaagacgacgagaacttggcattgaagagtctcttcctgagacagctgct
gacaaaagccaagattctgggtctgataatcgtataaacacagtcagtctcaaggaagcc
ttggaaaggtttgatcacagcccaaccccgtctgcttcctcccggagttcaagaaaatca
tctcacacagcagtctcagacccttcctcaacaccaacaaagatcccaacggacactagc
actcctcccagaccacatttaccatctcatgaaaagatggcgccaaggagggcatcattt
agtagtcagtccataaattcccagtctgttggtcagtcgttaacacagccagcgatgtct
caagctgcaaatttaccaattccacaaggcatgtcccagtttcagttttcagctcaacta
ggagccatgcagcatctaaaagaccaattagagcaacgaacacggatgatagaagcaaat
attcatcgacaacaagaagaactaagaaaaattcaggaacaacttcaaatggtccatggt
caagggctgcaaatgtttttacaacaatcaacccctggtttgaattttggttctgttcaa
ctttcttctggaaattcatctaacatccagcaactcgcacctataaatatgcagggccag
gtcgttcaaactaaccaaattcaaagtggaatgaatactggacacattggcacaactcaa
catatgataccacagcagactttacagagtacatcaagtcagcagagtcaacaaaatgta
ctgagtgggcacagtcagcaaacttctcttcccagtcagacgcagagcactctcacagcg
ccgctctataacactatggtgatctctcagccggcagccggaggcatggtccagattcca
tccagcatgccgcagaacagtacccagagcgccgcagtaactacattcactcaggacaga
cagatcagattttctcaaggtcagcagctcgtgaccaaattagtaactgcgcctgtagct
tgtggggcagtgatggtacctagcacaatgctcatgggtcaggtggtgaccgcctaccct
acttttgctacacaacagcagcagtcacagacactgtcagtcacacaacagcagcagcag
cagagctcccaggaacagcagctcgcttcagttcagcaaccgtctcaggctcagctgacc
caaccaccgcagcagtttttacagacttcaaggttgctccacgggaatccttcaactcag
cttatcctctctgctgcgtttccactacaacagagcactttccctcagtcgcatcaccag
cagcaccagtctcagcaacagcagcagctgagccggcacaggactgacagtgtgaccgat
ccttccaaggttccgccacagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system