KEGG   Canis familiaris (dog): 475163Help
Entry
475163            CDS       T01007                                 

Gene name
UGT2A1, UGT2A2
Definition
UDP glucuronosyltransferase 2 family, polypeptide A1, complex locus
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
cfa  Canis familiaris (dog)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    475163 (UGT2A1)
   00053 Ascorbate and aldarate metabolism
    475163 (UGT2A1)
   00500 Starch and sucrose metabolism
    475163 (UGT2A1)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    475163 (UGT2A1)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    475163 (UGT2A1)
   00860 Porphyrin and chlorophyll metabolism
    475163 (UGT2A1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    475163 (UGT2A1)
   00982 Drug metabolism - cytochrome P450
    475163 (UGT2A1)
   00983 Drug metabolism - other enzymes
    475163 (UGT2A1)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    475163 (UGT2A1)
Enzymes [BR:cfa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     475163 (UGT2A1)
Glycosyltransferases [BR:cfa01003]
 Others
  Hydrophobic molecule
   475163 (UGT2A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
13
AA seq 530 aa AA seqDB search
MMSTKWISAIVLLQLCYTGCGFCGKVLVWPCDMSHWLNLRIILEKLTERGHEVTVLVSPQ
SFIIDYNKPSTLKFEVIPVPRDREAAEKSLNDFLDIATNVMPTLSRWQSALKLQEFFHQI
TGNLKLLCETVAYNQSIMKKLREANYNVMVIDPALPCGELIAELLGVPFVYTLRFSMGDT
VEKHCGKLPAPLSYVPVTMAALTDRMTFLQRVKNLMFSIFFNLWIHQYNNQFWDQFYSEV
LGRPTTLCEIMGKAEIWLIRTYWDFEFPRPYLPNFEFVGGLHCKPAKPLPKEMEEFVQSS
GEDGVVVFSLGSMVKNLTDEKANLIASALAQIPQKVLWRYKGNKPATLGTNTRLYDWIPQ
NDLLGHPKTKAFITHGGTNGIYEAIYHGVPMVGVPMFADQPDNIAHMKAKGAAVEVNINT
MTSADLLHALRTVINEPSYKENATRLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRPA
SHDLTWFQYHSLDVIGFLLACVATAIFLVTKCCLFSCRKFNKAGKKKKRE
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgatgtctacaaaatggatttcagcaattgtgctgctgcagctctgctacactggctgt
ggattctgtgggaaggtcctggtgtggccctgtgacatgagccattggctcaatctaagg
attattctggagaaactcacagaaaggggccatgaggtgactgtgttggtgtctccacag
agtttcatcattgactacaacaagccttccacactgaaatttgaggtgatccctgtgcca
cgcgacagagaggctgctgaaaaatcactaaatgactttttagacatagctactaatgtt
atgccaacattgtcacgctggcagtcagcattaaaactgcaagagttctttcatcaaata
acaggaaacttaaaactcctatgtgagactgtagcctacaaccagtcaatcatgaagaaa
ctccgggaagctaactacaacgtaatggtcatagaccctgcattaccctgtggagagctg
attgctgaactactgggggtcccttttgtgtacacactaaggttttctatgggtgacact
gtggaaaaacactgtgggaagcttccagctccactttcctatgttcctgttaccatggcg
gcactaacagacagaatgacttttctgcaaagggtaaaaaatttaatgttctccattttc
tttaacttatggatccaccaatataacaatcagttttgggaccagttttacagtgaagta
ttaggaagacccactacattatgtgagattatggggaaagcagaaatttggctaatccgg
acatattgggattttgaatttcctcgcccatacttacccaattttgagtttgtaggaggg
ttgcactgtaaacctgccaaaccattacctaaggaaatggaagaatttgtccaaagttca
ggtgaagatggtgttgtggtgttttctctggggtcaatggtcaaaaatctcacagatgaa
aaagccaatctcattgcctcggctcttgcccagattccacagaaggttttatggagatac
aaaggaaacaaaccagccacgttgggaaccaatactcggctctatgactggataccccag
aatgatcttcttggtcatcccaaaacaaaagcttttatcactcacggtggaaccaatggg
atctatgaagctatttatcacggggttcctatggtgggagtgcctatgtttgctgatcag
cctgacaacatcgctcacatgaaggccaaaggagcagctgtggaggtgaacatcaacaca
atgaccagtgcagatctgctccatgccctgagaacagtcattaatgaaccttcttataaa
gagaatgctacaagattatcgaggattcaccatgatcaacctgtaaagcccctggaccga
gcagtcttctggattgagtttgtcatgcgccacaaaggagccaagcacctgcggccagcc
tcccatgacctcacctggttccagtaccactccttggatgtgattgggtttctgctggcc
tgtgtggcgactgctatattcttggtcacaaaatgttgtttgttttcttgtcgaaaattt
aataaagcaggaaagaagaaaaagagggagtag

DBGET integrated database retrieval system