KEGG   Canis familiaris (dog): 475192Help
Entry
475192            CDS       T01007                                 

Gene name
CPA1
Definition
(RefSeq) carboxypeptidase A1
  KO
K08779  carboxypeptidase A1 [EC:3.4.17.1]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04972  Pancreatic secretion
cfa04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    475192 (CPA1)
   04974 Protein digestion and absorption
    475192 (CPA1)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.1  carboxypeptidase A
     475192 (CPA1)
Peptidases [BR:cfa01002]
 Metallo Peptidases
  Family M14: carboxypeptidase A family
   475192 (CPA1)
Chaperones and folding catalysts [BR:cfa03110]
 Intramolecular chaperones
  Other peptidases
   475192 (CPA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M14 Propep_M14 Phage_min_tail
Motif
Other DBs
NCBI-GeneID: 475192
NCBI-ProteinID: XP_005628437
Ensembl: ENSCAFG00000024968
UniProt: E2RJL0
Position
14
AA seq 419 aa AA seqDB search
MRGLLLLSVLLGAVLGKEDFVGHQVLRISAVDEAQVQKVKELEDLEHLKLDFWRGPGRPG
SPIDVRVPLPSSQAVKVFLEAHGIGYTVMIEDVQSLLDEEQEQMFAFQAWARSTDTFNYA
TYHTLEEIYGFLDLLVAEHPQLVSKLQIGSSYEGRPIYVLKFSTGGSKRPAIWIDTGIHS
REWVTQASGVWFAKKITQDYGQDSTLTAILDSMDIFLEIVTNPDGFAFTHSKNRMWRKTR
SLTPGSACVGVDPNRNWDTGFGLAGASSNPCSETYHGKFANSEVEVKSIVDFVKSHGNIK
AFISIHSYSQLLLYPYGYKAEAAPDQQELDQLAKAAVTALASLYGTKFKYGSIIKTIYQA
SGSTVDWTYSQGIKYSFTFELRDTGRYGFLLPASQIIPTAQETWLALRTIMEHTLNHPY
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgagggggctgctgcttttaagtgtgttgctaggggctgtccttggcaaagaggacttt
gtggggcaccaggtgctccgaatctctgctgtagatgaagcccaggtccagaaggtgaag
gagctggaggacctggagcacctgaagctggacttctggcggggccctggccgcccgggc
tcccccatcgatgtccgagtgccgctccccagcagccaggccgtcaaagtcttcctggag
gcgcacggcatcgggtacaccgtcatgatcgaggacgtgcagtcactgctggacgaggag
caggagcagatgttcgccttccaggcctgggcccgctccaccgacacctttaactacgcc
acctaccacaccctggaggagatctatggcttcctggacttgctggtggccgagcacccg
cagcttgtcagcaagctccagattggcagcagctacgaaggccgtcccatctacgtgctg
aagttcagcacgggggggagcaaacgccctgccatctggatcgacacaggcatccattcc
cgggagtgggtcacccaggccagcggggtctggtttgcaaagaagatcacacaagactat
ggccaggactccacactcacagccattcttgattccatggacatcttcctggagattgtc
accaaccccgacggttttgccttcactcacagcaagaatcgcatgtggcgcaagacccga
tccctcacgccgggctccgcctgtgttggagtggatcccaaccggaactgggacaccggc
ttcggattggccggagccagcagcaacccctgctcagagacttaccacggcaagttcgcc
aattccgaagtggaggttaagtccatcgtggactttgtgaagagccacggaaacatcaag
gccttcatctccatccacagctactcccagctgctcctgtatccctacggttacaaagca
gaagcggcccctgaccagcaagagctggatcagctggccaaggctgctgtgacagcgctc
gcctctctgtatgggaccaagttcaagtatggcagcatcatcaaaacaatttaccaagcc
agtggaagcactgttgactggacctacagccagggcatcaagtactccttcaccttcgag
ctccgggacacggggcgctacggcttcctgctgccggcctctcagatcatccccacggcc
caggagacgtggctggcgcttcggaccatcatggagcacaccctgaatcacccctactga

DBGET integrated database retrieval system