KEGG   Canis familiaris (dog): 475253Help
Entry
475253            CDS       T01007                                 

Gene name
ITGB8
Definition
integrin, beta 8
Orthology
K06591  
integrin beta 8
Organism
cfa  Canis familiaris (dog)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Cell adhesion molecules (CAMs)
Regulation of actin cytoskeleton
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:cfa04151]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:cfa04512]
Environmental Information Processing; Signaling molecules and interaction; Cell adhesion molecules (CAMs) [PATH:cfa04514]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:cfa04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:cfa04510]
Human Diseases; Cardiovascular diseases; Hypertrophic cardiomyopathy (HCM) [PATH:cfa05410]
Human Diseases; Cardiovascular diseases; Arrhythmogenic right ventricular cardiomyopathy (ARVC) [PATH:cfa05412]
Human Diseases; Cardiovascular diseases; Dilated cardiomyopathy (DCM) [PATH:cfa05414]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
14
AA seq 779 aa AA seqDB search
MCRSALAFFAAAFVRLQNCRPGPAPFLRAAWVLLVVLGLGQSEDNRCTSSNAASCTKCLA
LGPECGWCAQEDFISGGLRSERCDIISNLISKGCSTDSIEYPSVHVIPSENEINTQVTPG
EVLIQLRPEAEANFMLKIHPLKKYPVDLYYLVDVSASMHNNIEKLNSVGNDLSRKMAYFS
RDFRLGFGSYVDKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFEKAV
HRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIVV
PNDGNCHLKNNIYVRSTSMEHPSLGQLSEKLIDNNINVIFAVQGKQFHWYKDLLPLLPGT
IAGEIESKAANLNNLVIDAYQKLISEVKVQVENQVKGVYFNITAICPDGTRKPGTDGCGN
VTSNDEVLFNVTVTMKKCDVTGGKSYAIIKPIGFNETTKIHIHRNCSCQCDDGRGSKRKC
VDEIFLDAKCFQCNENKCHFDEAQFPSETCKSHKDQPVCSGRGVCVCGKCLCHKVKFGKV
YGKYCEKDDFSCPYHHGNLCAGHGECEAGRCQCFSGWEGDRCQCPSASAQHCVNPKGQVC
SGRGTCVCGRCECTDPGSIGRFCEHCPTCHTACSENWNCVQCLRPHNLSQAILDRCKTSC
ALMEQHYMEQTSECFSSPSYLRIFFIIFIVTFLIGLLKVLIIRQVILQWNSNKIKSSADY
RVSASKKDKLILQSVCTRAVTYRREKPEEIKMDISKLNAHETFRRRQTVLDHAGCWLST
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
atgtgccgctccgctctggctttttttgccgccgcatttgtccgcctgcaaaactgccgg
ccgggtccagccccgttccttcgggcggcctgggtgcttttagttgttcttggactgggc
caaagtgaagacaatagatgtacatcttcaaatgcagcatcctgcaccaaatgccttgcg
ctgggtccggaatgtggatggtgtgctcaagaggatttcatttcaggtggattaaggagt
gaacgttgtgatattatttccaacttaataagcaaaggctgttcgactgattcaatagaa
tacccatctgtacatgtaataccaagtgaaaatgaaattaatacccaggtgacaccagga
gaagtgttgatccagctgcgtccagaagctgaagctaattttatgctgaaaattcatcct
ctgaagaaatatcctgtggatctttattacctggttgatgtctcagcatcaatgcacaat
aatattgaaaaattaaattccgttggaaatgatttatctagaaaaatggcatatttttcc
cgtgacttccgtcttggatttggctcctatgttgataaaacagtttcaccatacattagc
atccacccagaaaggattcataatcaatgcagtgactacaatttagattgtatgcctcct
catggatacatccatgtgctatctttgacggagaacattactgagtttgaaaaagcagtt
cacagacaaaagatctctggaaacatagatacacctgaaggaggttttgatgccatgctt
caggcagctgtctgtgagagtcatattggatggcgaaaagaagctaaaagattgctgctg
gtgatgacagatcagacatctcatcttgctcttgatagcaaattggcaggaatagtggtg
ccaaatgatggaaactgccatctcaaaaacaacatctacgtcagatcaacaagcatggaa
catccctcactaggccaactttctgaaaagttaatagacaacaacattaatgtcatcttt
gcagttcaaggaaaacagtttcactggtataaggatcttctacccctcttgcctggcacc
atcgctggtgaaatagaatcaaaggctgcaaacttaaataatttggtaatagatgcctat
cagaaactcatttcagaagtgaaagttcaggtggaaaaccaggtaaaaggagtttatttt
aatattactgccatctgtccagatgggacccgaaaaccaggcacagacggatgtggaaat
gtgacaagcaatgacgaagttcttttcaatgtaacagttacaatgaaaaaatgtgatgtc
acaggaggaaagagctatgcaataatcaaacctattggtttcaatgaaaccactaaaatt
cacatacacagaaactgcagctgtcagtgtgatgatgggagaggatctaaacgaaagtgt
gtagatgaaatttttctagatgccaagtgtttccagtgtaatgagaataaatgtcatttt
gatgaggctcaatttccttctgagacttgcaaatcacacaaggatcaacctgtttgcagt
ggacgaggagtttgtgtttgtggaaaatgtttatgtcacaaagtaaagtttggaaaagtg
tatggaaaatactgtgagaaggatgatttctcttgtccatatcaccatggaaatctgtgt
gctgggcatggagagtgtgaagcgggcagatgccagtgcttcagtggctgggaaggggat
cggtgccagtgcccgtcagcatcagcccagcactgtgtcaatccaaagggccaagtgtgt
agtggaagaggtacatgtgtatgtggcaggtgtgagtgcaccgatcctgggagcattggc
cgcttctgtgaacactgccccacgtgtcacacagcctgcagtgaaaactggaattgtgtg
caatgccttcgccctcacaacctgtctcaagctatacttgatcgttgtaaaacctcatgt
gctcttatggaacagcattatatggagcaaacatcagaatgtttctctagcccaagctat
ttaagaatatttttcatcatcttcatagttacattcttgattgggttgcttaaagtcctt
atcattaggcaggtgatactacaatggaatagtaataaaattaagtcctcggcggattac
agggtgtcagcctcaaaaaaggacaagttgattctgcaaagcgtttgcacaagagcagta
acctaccgacgtgagaaacctgaagaaataaaaatggatatcagcaagttaaatgctcat
gaaactttcaggaggagacaaactgttctagatcatgctggttgctggttgtccacttga

DBGET integrated database retrieval system