KEGG   Canis familiaris (dog): 475258Help
Entry
475258            CDS       T01007                                 

Gene name
CYCS
Definition
(RefSeq) cytochrome c, somatic
  KO
K08738  cytochrome c
Organism
cfa  Canis familiaris (dog)
Pathway
cfa01100  Metabolic pathways
cfa01524  Platinum drug resistance
cfa04115  p53 signaling pathway
cfa04210  Apoptosis
cfa04215  Apoptosis - multiple species
cfa04932  Non-alcoholic fatty liver disease (NAFLD)
cfa05010  Alzheimer's disease
cfa05012  Parkinson's disease
cfa05014  Amyotrophic lateral sclerosis (ALS)
cfa05016  Huntington's disease
cfa05134  Legionellosis
cfa05145  Toxoplasmosis
cfa05152  Tuberculosis
cfa05161  Hepatitis B
cfa05164  Influenza A
cfa05167  Kaposi's sarcoma-associated herpesvirus infection
cfa05168  Herpes simplex infection
cfa05200  Pathways in cancer
cfa05210  Colorectal cancer
cfa05222  Small cell lung cancer
cfa05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    475258 (CYCS)
   04215 Apoptosis - multiple species
    475258 (CYCS)
   04115 p53 signaling pathway
    475258 (CYCS)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    475258 (CYCS)
   05210 Colorectal cancer
    475258 (CYCS)
   05222 Small cell lung cancer
    475258 (CYCS)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    475258 (CYCS)
   05012 Parkinson's disease
    475258 (CYCS)
   05014 Amyotrophic lateral sclerosis (ALS)
    475258 (CYCS)
   05016 Huntington's disease
    475258 (CYCS)
  Cardiovascular diseases
   05416 Viral myocarditis
    475258 (CYCS)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    475258 (CYCS)
  Infectious diseases
   05134 Legionellosis
    475258 (CYCS)
   05152 Tuberculosis
    475258 (CYCS)
   05164 Influenza A
    475258 (CYCS)
   05161 Hepatitis B
    475258 (CYCS)
   05168 Herpes simplex infection
    475258 (CYCS)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    475258 (CYCS)
   05145 Toxoplasmosis
    475258 (CYCS)
  Drug resistance
   01524 Platinum drug resistance
    475258 (CYCS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 475258
NCBI-ProteinID: NP_001183974
Ensembl: ENSCAFG00000002856
UniProt: P00011
Position
14
AA seq 105 aa AA seqDB search
MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITW
GEETLMEYLENPKKYIPGTKMIFAGIKKTGERADLIAYLKKATKE
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatgttgagaagggcaagaagatttttgttcagaagtgtgcgcagtgccatact
gtggaaaagggaggcaagcacaagactgggccaaacctccacggtttatttgggcggaag
accggtcaggcccctggattttcttacacggatgccaacaagaacaaaggcatcacctgg
ggagaggagaccctgatggagtatttggagaatcccaagaagtacatccctggaacaaaa
atgatcttcgctggcattaagaagacaggggaaagagcagacttaatagcttatctcaaa
aaagctactaaggagtaa

DBGET integrated database retrieval system