KEGG   Canis familiaris (dog): 475258Help
Entry
475258            CDS       T01007                                 

Gene name
CYCS
Definition
cytochrome c, somatic
Orthology
K08738  
cytochrome c
Organism
cfa  Canis familiaris (dog)
Pathway
Sulfur metabolism
Metabolic pathways
p53 signaling pathway
Apoptosis
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Amyotrophic lateral sclerosis (ALS)
Huntington's disease
Legionellosis
Toxoplasmosis
Tuberculosis
Hepatitis B
Influenza A
Herpes simplex infection
Pathways in cancer
Colorectal cancer
Small cell lung cancer
Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    475258 (CYCS)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    475258 (CYCS)
   04115 p53 signaling pathway
    475258 (CYCS)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    475258 (CYCS)
   05210 Colorectal cancer
    475258 (CYCS)
   05222 Small cell lung cancer
    475258 (CYCS)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    475258 (CYCS)
   05012 Parkinson's disease
    475258 (CYCS)
   05014 Amyotrophic lateral sclerosis (ALS)
    475258 (CYCS)
   05016 Huntington's disease
    475258 (CYCS)
  Cardiovascular diseases
   05416 Viral myocarditis
    475258 (CYCS)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    475258 (CYCS)
  Infectious diseases
   05134 Legionellosis
    475258 (CYCS)
   05152 Tuberculosis
    475258 (CYCS)
   05164 Influenza A
    475258 (CYCS)
   05161 Hepatitis B
    475258 (CYCS)
   05168 Herpes simplex infection
    475258 (CYCS)
   05145 Toxoplasmosis
    475258 (CYCS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
14
AA seq 105 aa AA seqDB search
MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITW
GEETLMEYLENPKKYIPGTKMIFAGIKKTGERADLIAYLKKATKE
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatgttgagaagggcaagaagatttttgttcagaagtgtgcgcagtgccatact
gtggaaaagggaggcaagcacaagactgggccaaacctccacggtttatttgggcggaag
accggtcaggcccctggattttcttacacggatgccaacaagaacaaaggcatcacctgg
ggagaggagaccctgatggagtatttggagaatcccaagaagtacatccctggaacaaaa
atgatcttcgctggcattaagaagacaggggaaagagcagacttaatagcttatctcaaa
aaagctactaaggagtaa

DBGET integrated database retrieval system