KEGG   Canis familiaris (dog): 475316Help
Entry
475316            CDS       T01007                                 

Gene name
PPT1
Definition
(RefSeq) palmitoyl-protein thioesterase 1
  KO
K01074  palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00062  Fatty acid elongation
cfa01100  Metabolic pathways
cfa01212  Fatty acid metabolism
cfa04142  Lysosome
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Lipid metabolism
   00062 Fatty acid elongation
    475316 (PPT1)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    475316 (PPT1)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     475316 (PPT1)
Lipid biosynthesis proteins [BR:cfa01004]
 Fatty acid synthase
  Component type
   475316 (PPT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Palm_thioest Glyco_hydro_98M
Motif
Other DBs
NCBI-GeneID: 475316
NCBI-ProteinID: NP_001010944
Ensembl: ENSCAFG00000003004
UniProt: Q5JZR0
Position
15
AA seq 306 aa AA seqDB search
MASPSCLWLLAVALLPGSGAARAPWRLDPAAPLPLVIWHGMGDSCCNPLSMGAIKKMVEE
KIPGIYVLSLEIGKTLMEDVENSFFLNVNSQVTTVCQILAKDPKLHQGYNAMGFSQGGQF
LRAVAQRCPSPPMINLISIGGQHQGVYGLPRCPGESSHICDLIRKTLNAGAYNKAIQERL
VQAEYWHDPIKEDTYRNHSIFLADINQERGVNESYKRNLMALKKFVMVKFLNDSIVDPVD
SEWFGFYRSGQAKETIPLQETALYTQDRLGLKEMDNAGQLVFLAVEGDHLQLSQEWFYAH
IIPFLE
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgcccagctgcctgtggctcctggccgtcgccctcctgccggggtccggcgct
gcccgggcgccctggcgtctggacccggccgcgccgctgccgctggtgatctggcatggg
atgggagacagctgttgtaatcccttaagcatgggagctattaaaaaaatggttgaggag
aaaatacctggaatttacgtcttatctttagagattgggaagaccctgatggaggatgtg
gagaacagcttcttcttgaatgtcaattcccaagtaacaactgtgtgtcagattcttgct
aaggatcctaaattgcatcaaggctacaatgctatgggattctctcagggaggccaattt
ctgagggcagtggctcagagatgcccatcacctcccatgatcaatctaatctcgattggg
ggacaacatcaaggtgtttatggactccctcggtgcccaggggagagctctcacatctgt
gacttgatcagaaaaacactgaatgctggggcttacaacaaagctattcaagaacgcctg
gtgcaagcagagtactggcacgaccccataaaggaggacacgtaccgcaaccacagcatc
ttcctggccgatattaatcaggagcggggcgtcaatgagtcctacaagagaaacctgatg
gccttgaagaagtttgtgatggtgaaatttctcaacgattccattgtggatcctgtggac
tctgagtggtttggattctacagaagtggccaagccaaggaaaccattcccttgcaggag
accgctctgtacacacaggaccgcctggggctaaaggaaatggataatgcaggacagcta
gtgttcctggctgtagaaggggaccatcttcaactgtctcaggaatggttttatgcccac
atcatacccttccttgagtaa

DBGET integrated database retrieval system