KEGG   Canis familiaris (dog): 475316Help
Entry
475316            CDS       T01007                                 

Gene name
PPT1
Definition
palmitoyl-protein thioesterase 1 (EC:3.1.2.22)
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
cfa  Canis familiaris (dog)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Class
Metabolism; Overview; Fatty acid metabolism [PATH:cfa01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:cfa00062]
Cellular Processes; Transport and catabolism; Lysosome [PATH:cfa04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
15
AA seq 306 aa AA seqDB search
MASPSCLWLLAVALLPGSGAARAPWRLDPAAPLPLVIWHGMGDSCCNPLSMGAIKKMVEE
KIPGIYVLSLEIGKTLMEDVENSFFLNVNSQVTTVCQILAKDPKLHQGYNAMGFSQGGQF
LRAVAQRCPSPPMINLISIGGQHQGVYGLPRCPGESSHICDLIRKTLNAGAYNKAIQERL
VQAEYWHDPIKEDTYRNHSIFLADINQERGVNESYKRNLMALKKFVMVKFLNDSIVDPVD
SEWFGFYRSGQAKETIPLQETALYTQDRLGLKEMDNAGQLVFLAVEGDHLQLSQEWFYAH
IIPFLE
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgcccagctgcctgtggctcctggccgtcgccctcctgccggggtccggcgct
gcccgggcgccctggcgtctggacccggccgcgccgctgccgctggtgatctggcatggg
atgggagacagctgttgtaatcccttaagcatgggagctattaaaaaaatggttgaggag
aaaatacctggaatttacgtcttatctttagagattgggaagaccctgatggaggatgtg
gagaacagcttcttcttgaatgtcaattcccaagtaacaactgtgtgtcagattcttgct
aaggatcctaaattgcatcaaggctacaatgctatgggattctctcagggaggccaattt
ctgagggcagtggctcagagatgcccatcacctcccatgatcaatctaatctcgattggg
ggacaacatcaaggtgtttatggactccctcggtgcccaggggagagctctcacatctgt
gacttgatcagaaaaacactgaatgctggggcttacaacaaagctattcaagaacgcctg
gtgcaagcagagtactggcacgaccccataaaggaggacacgtaccgcaaccacagcatc
ttcctggccgatattaatcaggagcggggcgtcaatgagtcctacaagagaaacctgatg
gccttgaagaagtttgtgatggtgaaatttctcaacgattccattgtggatcctgtggac
tctgagtggtttggattctacagaagtggccaagccaaggaaaccattcccttgcaggag
accgctctgtacacacaggaccgcctggggctaaaggaaatggataatgcaggacagcta
gtgttcctggctgtagaaggggaccatcttcaactgtctcaggaatggttttatgcccac
atcatacccttccttgagtaa

DBGET integrated database retrieval system