KEGG   Canis familiaris (dog): 475395Help
Entry
475395            CDS       T01007                                 

Gene name
RAC1, RNASE1
Definition
ribonuclease pancreatic-like
Orthology
K01168  
pancreatic ribonuclease [EC:3.1.27.5]
Organism
cfa  Canis familiaris (dog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
15
AA seq 151 aa AA seqDB search
MAQEKFLVLLPLVVLALLGLACVQPSLARESKAMKFQRQHMDSHPAAISASYCNLMMKRR
NMTDGWCKPVNTFVHEPLADVQAVCSQKDVLCKNGQSNCHQSRSQMNITDCRLKNGSKFP
KCVYTTTQKEQYIVVACEGNPHVPVHFDACL
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atggctcaggagaagttcttggtgctgttgccactagtggtcctggcgctgctggggctg
gcctgcgtgcagccttctctggccagggagtcgaaggccatgaagttccaacggcagcac
atggactcgcaccccgccgccatcagcgccagctactgcaacctgatgatgaagcgccgc
aacatgacggatgggtggtgcaagcccgtgaacaccttcgtgcacgagcctctggcagac
gtccaggccgtctgctcccagaaggatgtgctctgcaagaacgggcagtccaactgtcac
cagagccgctcccagatgaacatcaccgactgccgcctgaagaacggctccaagttcccc
aagtgcgtgtacacgaccacgcagaaggagcagtacatcgtcgtggcctgtgaggggaac
ccccacgtgccagtgcactttgatgcgtgtctgtag

DBGET integrated database retrieval system