KEGG   Canis familiaris (dog): 475424Help
Entry
475424            CDS       T01007                                 

Gene name
EEA1
Definition
early endosome antigen 1
Orthology
K12478  
early endosome antigen 1
Organism
cfa  Canis familiaris (dog)
Pathway
Endocytosis
Phagosome
Tuberculosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:cfa04144]
Cellular Processes; Transport and catabolism; Phagosome [PATH:cfa04145]
Human Diseases; Infectious diseases; Tuberculosis [PATH:cfa05152]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
15
AA seq 1447 aa AA seqDB search
MMKTPGRVGSQGSDLDSSAAPINTVDVNNESSSEGFICPLCMKRCITAIDLSEHYQQVHT
ENETRGQELLNDSSVTGFICPQCMKSLGSADELFKHYEVVHDAGNDSSHGGEALALKRDD
ITLLRQEIQDLQASLKEEKWYSEELKKELEKFQGLQQQESKPDGLVADSSAELQSLEQQL
EEAQTENFNIKQMKDLFEQKAAQLATEIADVKSKYDEERSLREAAEQKVTHLTEELNKET
TIIQDLKTELLQRPGIEDVAVLKKELVQVQTLMDNMTLEREKESEKLKDECKKLQAEFVN
SEATISQLRSELAKGPQEVAVYVQELQKLKSSLNELTQKNQNLSEKLLKKELEFTQLEEK
HNEECVSRKNIQASLHQKDLDCQQLQSRLSASETSLQRIQAELGEKGEATQKLKEELSEV
ETKYQHLKAEFKQLQQQREEKDQHGLQLQSEVNQLHSKLLETERQLGEAHGRLKEQRQLS
SEKLMDKEQQVADLQLKLSRLEEQLKEKVTNSTELQHQLDKMKQQHQEQQALQQSTTAKL
REAQNDLEQVLRQIGDKDQKIQNLEALLQKSKENISLLEKEREDLYAKIQAGEGETAVLN
QLQEKNHNLQEQVTQLTEKLKNQSESHKQAQENLHDQVQEQKAHLRAAQDRVLSLETSVN
ELNSQLNESKEKVSQLDIQIKAKTELLLSAEAAKTAQRADLQNHLDTAQNALQDKQQELS
KITTQLDQVTTKLQDKQEHCSQLESHLKEYKEKHLSLEQKTEELEGQIKKLEADTLEVKG
SKEQALQELQLQRQLNTDLELRVTELSKQLEMEKEIVSSTKLDLQKKSEALENIKQMLTE
QEEEKKLLKREIENLSQDAKMQHKELNNKIQTAATELQKVKMEKETLMTELSATKENFSK
VSESLKNSKSEFEKENQKGKAAILDLEKTCKELKHQLQVQTENTLKEQNELKKSLEKEKQ
TSHQLKLELNSVQGQVVQAQNTLKQKEKEEQQLQGTINELKQLTEQKKKQIEALQGEVKT
AISQKTELESKLQQQSTQAAQELTAEKEKMSVLQNTYEKSQDNLKQLQSDFYGKESELLA
TRQDLKSVEEKLSLAQEDLISNRNQIGNQNKLIQELKTAKAALEQDSAKKEQQLKEQCKT
LQDIQKEKSLKEKELANEKSKLAEIEEIKCRQEKEIAKLSEEFKSHKQESIKEVTNLKDA
KQLLIQQKLELQGRVDSLKATLEQEKRNQQMLKEQMKKEEDELKKEFTEKEAKLHSEIKE
KEIGMKKHEENEAKLTMQITALNENLGTVKKEWQSSQRRVSELEKQTDDLRGEIAVLEAT
VQNNQDERRALLERYLKGEGEIEKLQTKVLELQRKLDNTTAAVQELGRENQSLQIKHTQA
LNRKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKKPVRVCDA
CFNDLQG
NT seq 4344 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaactcctgggagagttggctctcaaggttctgatttagattcatcagcagct
cctataaacacagtagatgtcaataatgaaagctcttcagagggtttcatctgtccatta
tgtatgaaaagatgtataactgctattgatttgtcggagcattaccagcaagtgcacact
gaaaatgaaacaagaggacaggaactgcttaatgactccagtgttactggtttcatatgt
ccccagtgtatgaaatcccttggatctgctgatgaacttttcaaacactatgaggtagtt
catgatgctggtaatgactcaagtcatggaggagaggctcttgctctgaagcgagatgat
ataacactacttagacaagagatccaagaccttcaggcatcacttaaggaagaaaaatgg
tactcagaagaattaaagaaagaattagaaaaatttcaagggctccagcagcaagaatct
aaacctgatggattggtggctgactcatcagcagaactacagtctttggaacaacaatta
gaagaagcccaaacagaaaattttaatattaagcaaatgaaagacttatttgaacagaaa
gcagcccaacttgccactgaaattgcagatgttaagtcaaaatatgatgaagaaaggagt
cttcgagaagctgctgaacaaaaagtgacacatctgacagaagaattaaacaaagaaaca
actataattcaagatctgaagactgaattgcttcagagacctggtatagaagatgttgct
gtgctgaagaaagaactggtccaggttcaaacgctaatggacaacatgacattggaacgt
gagaaagaatctgaaaaactcaaagatgagtgtaaaaagttacaggcagaatttgttaac
tcagaggctacaataagccagctgaggagtgaacttgccaaaggcccccaggaagttgct
gtatatgtgcaggaactacaaaaacttaaaagttcacttaatgaattaacacagaaaaat
cagaatttgtctgaaaagttgctgaagaaagaactggagttcactcagttagaggagaaa
cataatgaagaatgtgtgagtagaaagaatatacaagcaagccttcatcaaaaagatcta
gattgtcagcaacttcagtcaagattatctgcatctgaaacctccctgcagagaatacaa
gcagaactaggtgaaaagggagaagctacacaaaagctcaaagaagaattatcagaagtg
gagactaagtaccagcatcttaaggctgaatttaaacagctacaacagcaaagagaagaa
aaagaccagcatgggttacaactccaaagtgaagttaatcaattacatagcaaacttctg
gagacagaacgtcaactaggtgaagctcatggtaggctaaaggaacagagacaactttca
agtgaaaaattgatggataaagaacaacaagtggctgatctacagctcaaactttctcgt
ttagaagaacagttgaaggaaaaagtaacaaattctacagaattgcagcatcaattagat
aaaatgaagcaacagcatcaagaacaacaagctcttcagcaaagcactacagcaaaactt
cgagaagctcagaatgatttagaacaagtactacgtcaaattggtgataaagaccaaaag
atccagaaccttgaagccttactacagaagagtaaagaaaatatttccttactagaaaaa
gaaagagaagatctttatgcaaaaattcaggctggtgaaggagagactgctgttcttaac
cagttacaagaaaaaaaccacaacttacaggaacaagtaactcaactaacagagaagctg
aagaatcagtcagaaagccataaacaagcccaggagaatttgcatgaccaagtacaagag
cagaaggcacatcttcgagctgcacaagaccgtgttctttctttagaaactagtgtcaat
gaattgaatagtcaattaaatgagagcaaggagaaggtctcccagcttgacatacagatt
aaagccaaaactgaattactgctatcagcagaagcagcaaaaactgctcagagagcagat
cttcagaatcatttggacacagcccaaaatgcattacaagataaacagcaggagttatct
aagatcactactcagttggatcaggtcactacaaagttgcaggataagcaagaacattgc
agtcagctggaaagtcatcttaaagaatataaagagaaacacctctctttagaacaaaaa
actgaagaattagaaggtcaaattaagaaactagaagctgatactcttgaagttaaagga
agcaaggaacaagctttgcaggaactacaactacaaagacagctgaatacagatttagag
cttagagtcacagaattgagtaaacagcttgaaatggagaaagaaatagtatccagtaca
aagttggatctacagaaaaaatctgaagcccttgaaaatattaagcaaatgcttaccgag
caagaggaagaaaaaaaactccttaaacgagaaattgaaaatttaagtcaagatgcaaag
atgcagcacaaggaattgaataacaaaattcagacagcagcaacagaactacaaaaagtg
aagatggagaaagaaactctaatgacagagctttctgcaacaaaagagaatttttcaaaa
gtttctgaatctttgaagaactctaaaagtgaatttgaaaaggaaaatcagaaaggaaaa
gctgctatattagatttggaaaaaacttgcaaagaattaaagcatcagcttcaggtacag
acagagaatacacttaaggaacagaatgaactgaaaaagtcacttgaaaaagagaagcag
acttctcatcagttgaagttggaactcaattcagttcaaggacaagttgtacaggcccag
aatactttaaaacaaaaggaaaaagaagaacaacaacttcaggggaccataaatgagctg
aagcaattgactgaacagaagaaaaagcaaattgaagcactccaaggagaagttaaaact
gctatttcacagaagacagaacttgagagtaaactacagcagcagtccacacaagcagcc
caggaacttacagcagagaaagaaaaaatgtcagtgttacaaaatacctatgaaaaaagt
caggataatctaaagcagcttcagtctgatttctatgggaaggaatctgagcttcttgcc
accaggcaagatcttaagtctgtagaagagaagctttctctagcacaggaggacttgatt
tcaaacagaaatcaaattggaaaccaaaataaattgattcaagaactgaaaactgccaag
gctgcattggagcaggattctgcaaagaaagaacagcagttgaaggagcagtgtaaaaca
ctacaagatattcaaaaagaaaagtcactgaaagagaaagaactagcaaatgaaaaatct
aaattggcagagatagaggaaattaagtgtagacaggaaaaagaaattgctaaattgagt
gaagaattcaagtcccacaagcaagaaagcataaaggaggtaacaaatctcaaggatgcc
aaacaacttttgattcagcagaaattagagcttcaagggagagtagattctctgaaggcc
acccttgaacaggagaagagaaaccagcaaatgctaaaagagcagatgaaaaaggaagaa
gatgagctcaagaaagaatttactgagaaggaagctaaactgcattctgaaataaaagaa
aaagaaataggaatgaagaagcatgaagaaaacgaagctaaacttaccatgcagattaca
gcattaaatgaaaacttaggcactgtaaagaaggagtggcagtccagtcaacggagagtc
agtgagctcgagaaacagacagatgacttacggggtgaaattgcagtactggaagctaca
gttcagaataatcaggatgaaaggagagcactactagaaagatatcttaaaggagaaggt
gaaatagaaaaacttcaaaccaaagtcctagaattgcaaagaaagctggataataccact
gcagcggtgcaggaactgggtagagaaaatcaatcccttcaaatcaaacacacacaagcg
ttaaataggaaatgggctgaagacaatgaagtacaaaactgtatggcctgtgggaaaggc
ttctcagtaacagtgagacggcatcactgcagacagtgtggaaatatcttctgtgctgag
tgttcagccaaaaatgccttaactccttcttccaagaagcctgttcgtgtctgtgatgca
tgtttcaatgacttgcaaggataa

DBGET integrated database retrieval system