KEGG   Canis familiaris (dog): 475424Help
Entry
475424            CDS       T01007                                 

Gene name
EEA1
Definition
(RefSeq) early endosome antigen 1
  KO
K12478  
early endosome antigen 1
Organism
cfa  Canis familiaris (dog)
Pathway
Endocytosis
Phagosome
Tuberculosis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    475424 (EEA1)
   04145 Phagosome
    475424 (EEA1)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    475424 (EEA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
15
AA seq 1364 aa AA seqDB search
MKSLGSADELFKHYEVVHDAGNDSSHGGEALALKRDDITLLRQEIQDLQASLKEEKWYSE
ELKKELEKFQGLQQQESKPDGLVADSSAELQSLEQQLEEAQTENFNIKQMKDLFEQKAAQ
LATEIADVKSKYDEERSLREAAEQKVTHLTEELNKETTIIQDLKTELLQRPGIEDVAVLK
KELVQVQTLMDNMTLEREKESEKLKDECKKLQAEFVNSEATISQLRSELAKGPQEVAVYV
QELQKLKSSLNELTQKNQNLSEKLLKKELEFTQLEEKHNEECVSRKNIQASLHQKDLDCQ
QLQSRLSASETSLQRIQAELGEKGEATQKLKEELSEVETKYQHLKAEFKQLQQQREEKDQ
HGLQLQSEVNQLHSKLLETERQLGEAHGRLKEQRQLSSEKLMDKEQQVADLQLKLSRLEE
QLKEKVTNSTELQHQLDKMKQQHQEQQALQQSTTAKLREAQNDLEQVLRQIGDKDQKIQN
LEALLQKSKENISLLEKEREDLYAKIQAGEGETAVLNQLQEKNHNLQEQVTQLTEKLKNQ
SESHKQAQENLHDQVQEQKAHLRAAQDRVLSLETSVNELNSQLNESKEKVSQLDIQIKAK
TELLLSAEAAKTAQRADLQNHLDTAQNALQDKQQELSKITTQLDQVTTKLQDKQEHCSQL
ESHLKEYKEKHLSLEQKTEELEGQIKKLEADTLEVKGSKEQALQELQLQRQLNTDLELRV
TELSKQLEMEKEIVSSTKLDLQKKSEALENIKQMLTEQEEEKKLLKREIENLSQDAKMQH
KELNNKIQTAATELQKVKMEKETLMTELSATKENFSKVSESLKNSKSEFEKENQKGKAAI
LDLEKTCKELKHQLQVQTENTLKEQNELKKSLEKEKQTSHQLKLELNSVQGQVVQAQNTL
KQKEKEEQQLQGTINELKQLTEQKKKQIEALQGEVKTAISQKTELESKLQQQSTQAAQEL
TAEKEKMSVLQNTYEKSQDNLKQLQSDFYGKESELLATRQDLKSVEEKLSLAQEDLISNR
NQIGNQNKLIQELKTAKAALEQDSAKKEQQLKEQCKTLQDIQKEKSLKEKELANEKSKLA
EIEEIKCRQEKEIAKLSEEFKSHKQESIKEVTNLKDAKQLLIQQKLELQGRVDSLKATLE
QEKRNQQMLKEQMKKEEDELKKEFTEKEAKLHSEIKEKEIGMKKHEENEAKLTMQITALN
ENLGTVKKEWQSSQRRVSELEKQTDDLRGEIAVLEATVQNNQDERRALLERYLKGEGEIE
KLQTKVLELQRKLDNTTAAVQELGRENQSLQIKHTQALNRKWAEDNEVQNCMACGKGFSV
TVRRHHCRQCGNIFCAECSAKNALTPSSKKPVRVCDACFNDLQG
NT seq 4095 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcccttggatctgctgatgaacttttcaaacactatgaggtagttcatgatgct
ggtaatgactcaagtcatggaggagaggctcttgctctgaagcgagatgatataacacta
cttagacaagagatccaagaccttcaggcatcacttaaggaagaaaaatggtactcagaa
gaattaaagaaagaattagaaaaatttcaagggctccagcagcaagaatctaaacctgat
ggattggtggctgactcatcagcagaactacagtctttggaacaacaattagaagaagcc
caaacagaaaattttaatattaagcaaatgaaagacttatttgaacagaaagcagcccaa
cttgccactgaaattgcagatgttaagtcaaaatatgatgaagaaaggagtcttcgagaa
gctgctgaacaaaaagtgacacatctgacagaagaattaaacaaagaaacaactataatt
caagatctgaagactgaattgcttcagagacctggtatagaagatgttgctgtgctgaag
aaagaactggtccaggttcaaacgctaatggacaacatgacattggaacgtgagaaagaa
tctgaaaaactcaaagatgagtgtaaaaagttacaggcagaatttgttaactcagaggct
acaataagccagctgaggagtgaacttgccaaaggcccccaggaagttgctgtatatgtg
caggaactacaaaaacttaaaagttcacttaatgaattaacacagaaaaatcagaatttg
tctgaaaagttgctgaagaaagaactggagttcactcagttagaggagaaacataatgaa
gaatgtgtgagtagaaagaatatacaagcaagccttcatcaaaaagatctagattgtcag
caacttcagtcaagattatctgcatctgaaacctccctgcagagaatacaagcagaacta
ggtgaaaagggagaagctacacaaaagctcaaagaagaattatcagaagtggagactaag
taccagcatcttaaggctgaatttaaacagctacaacagcaaagagaagaaaaagaccag
catgggttacaactccaaagtgaagttaatcaattacatagcaaacttctggagacagaa
cgtcaactaggtgaagctcatggtaggctaaaggaacagagacaactttcaagtgaaaaa
ttgatggataaagaacaacaagtggctgatctacagctcaaactttctcgtttagaagaa
cagttgaaggaaaaagtaacaaattctacagaattgcagcatcaattagataaaatgaag
caacagcatcaagaacaacaagctcttcagcaaagcactacagcaaaacttcgagaagct
cagaatgatttagaacaagtactacgtcaaattggtgataaagaccaaaagatccagaac
cttgaagccttactacagaagagtaaagaaaatatttccttactagaaaaagaaagagaa
gatctttatgcaaaaattcaggctggtgaaggagagactgctgttcttaaccagttacaa
gaaaaaaaccacaacttacaggaacaagtaactcaactaacagagaagctgaagaatcag
tcagaaagccataaacaagcccaggagaatttgcatgaccaagtacaagagcagaaggca
catcttcgagctgcacaagaccgtgttctttctttagaaactagtgtcaatgaattgaat
agtcaattaaatgagagcaaggagaaggtctcccagcttgacatacagattaaagccaaa
actgaattactgctatcagcagaagcagcaaaaactgctcagagagcagatcttcagaat
catttggacacagcccaaaatgcattacaagataaacagcaggagttatctaagatcact
actcagttggatcaggtcactacaaagttgcaggataagcaagaacattgcagtcagctg
gaaagtcatcttaaagaatataaagagaaacacctctctttagaacaaaaaactgaagaa
ttagaaggtcaaattaagaaactagaagctgatactcttgaagttaaaggaagcaaggaa
caagctttgcaggaactacaactacaaagacagctgaatacagatttagagcttagagtc
acagaattgagtaaacagcttgaaatggagaaagaaatagtatccagtacaaagttggat
ctacagaaaaaatctgaagcccttgaaaatattaagcaaatgcttaccgagcaagaggaa
gaaaaaaaactccttaaacgagaaattgaaaatttaagtcaagatgcaaagatgcagcac
aaggaattgaataacaaaattcagacagcagcaacagaactacaaaaagtgaagatggag
aaagaaactctaatgacagagctttctgcaacaaaagagaatttttcaaaagtttctgaa
tctttgaagaactctaaaagtgaatttgaaaaggaaaatcagaaaggaaaagctgctata
ttagatttggaaaaaacttgcaaagaattaaagcatcagcttcaggtacagacagagaat
acacttaaggaacagaatgaactgaaaaagtcacttgaaaaagagaagcagacttctcat
cagttgaagttggaactcaattcagttcaaggacaagttgtacaggcccagaatacttta
aaacaaaaggaaaaagaagaacaacaacttcaggggaccataaatgagctgaagcaattg
actgaacagaagaaaaagcaaattgaagcactccaaggagaagttaaaactgctatttca
cagaagacagaacttgagagtaaactacagcagcagtccacacaagcagcccaggaactt
acagcagagaaagaaaaaatgtcagtgttacaaaatacctatgaaaaaagtcaggataat
ctaaagcagcttcagtctgatttctatgggaaggaatctgagcttcttgccaccaggcaa
gatcttaagtctgtagaagagaagctttctctagcacaggaggacttgatttcaaacaga
aatcaaattggaaaccaaaataaattgattcaagaactgaaaactgccaaggctgcattg
gagcaggattctgcaaagaaagaacagcagttgaaggagcagtgtaaaacactacaagat
attcaaaaagaaaagtcactgaaagagaaagaactagcaaatgaaaaatctaaattggca
gagatagaggaaattaagtgtagacaggaaaaagaaattgctaaattgagtgaagaattc
aagtcccacaagcaagaaagcataaaggaggtaacaaatctcaaggatgccaaacaactt
ttgattcagcagaaattagagcttcaagggagagtagattctctgaaggccacccttgaa
caggagaagagaaaccagcaaatgctaaaagagcagatgaaaaaggaagaagatgagctc
aagaaagaatttactgagaaggaagctaaactgcattctgaaataaaagaaaaagaaata
ggaatgaagaagcatgaagaaaacgaagctaaacttaccatgcagattacagcattaaat
gaaaacttaggcactgtaaagaaggagtggcagtccagtcaacggagagtcagtgagctc
gagaaacagacagatgacttacggggtgaaattgcagtactggaagctacagttcagaat
aatcaggatgaaaggagagcactactagaaagatatcttaaaggagaaggtgaaatagaa
aaacttcaaaccaaagtcctagaattgcaaagaaagctggataataccactgcagcggtg
caggaactgggtagagaaaatcaatcccttcaaatcaaacacacacaagcgttaaatagg
aaatgggctgaagacaatgaagtacaaaactgtatggcctgtgggaaaggcttctcagta
acagtgagacggcatcactgcagacagtgtggaaatatcttctgtgctgagtgttcagcc
aaaaatgccttaactccttcttccaagaagcctgttcgtgtctgtgatgcatgtttcaat
gacttgcaaggataa

DBGET integrated database retrieval system