KEGG   Canis familiaris (dog): 475495Help
Entry
475495            CDS       T01007                                 

Gene name
PGAM2
Definition
phosphoglycerate mutase 2 (muscle)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cfa  Canis familiaris (dog)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    475495 (PGAM2)
   01230 Biosynthesis of amino acids
    475495 (PGAM2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    475495 (PGAM2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    475495 (PGAM2)
Enzymes [BR:cfa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     475495 (PGAM2)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   475495 (PGAM2)
  Exosomal proteins of melanoma cells
   475495 (PGAM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
16
AA seq 288 aa AA seqDB search
MPPGSWPGWGWGRPVIRPGAPGRQPSLRSPPRPGTMSTHRLVMVRHGESTWNQENRFCGW
FDAELSEKGAQEAARGAQAIKDAKMEFDICYTSVLKRAIRTLWTILDGTDQMWLPVVRTW
RLNERHYGGLTGLNKAETAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYGSISKERRYAGL
KPGELPTCESLKDTIARALPFWNEEIAPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAI
MELNLPTGIPIVYELDQALKPTKPMRFLGDEETVRKAMEAVAAQGKAK
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgccgcctggcagttggccggggtgggggtggggacggccggttataaggccgggcgcc
ccgggaaggcagccgtcccttcgcagcccgcctcgtcccggcaccatgtccacccaccgc
ctcgtgatggttcggcacggcgagagcacctggaaccaggagaaccgcttctgcggctgg
ttcgacgccgagctgagcgagaagggggcccaggaggctgcaaggggggcccaggccatc
aaggacgccaagatggagtttgacatctgctacacgtccgtgctgaagagggccatccgc
accctctggaccatcctggacggcacggaccagatgtggctgcccgtggtgcgcacctgg
cgcctcaacgagcgccactacgggggcctcaccggcctcaacaaggcggagacggccgcc
aagcacggggaggagcaggtgaagatctggaggcgctccttcgacatcccgccacccccc
atggatgagaagcacccctactacggctccatcagcaaggagcgccggtacgcgggcctg
aagcccggggagttgcccacttgcgagagcctgaaggacaccatcgcgcgggccctcccc
ttctggaacgaggagatcgccccccagatcaaggctggcaagcgagtgctcatcgcggcc
catgggaacagcctgcggggcattgtcaagcacctggaagggatgtccgaccaggccatc
atggagctgaacctacccacggggatccccatcgtgtatgagctggaccaggcgctgaag
cccaccaagcctatgcggttcctgggtgacgaggaaaccgtgcggaaggccatggaggct
gtggccgcccagggcaaggctaagtga

DBGET integrated database retrieval system