KEGG   Canis familiaris (dog): 475495Help
Entry
475495            CDS       T01007                                 

Gene name
PGAM2
Definition
phosphoglycerate mutase 2 (muscle)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cfa  Canis familiaris (dog)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Glucagon signaling pathway
Central carbon metabolism in cancer
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    475495 (PGAM2)
   01230 Biosynthesis of amino acids
    475495 (PGAM2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    475495 (PGAM2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    475495 (PGAM2)
 Organismal Systems
  Endocrine system
   04922 Glucagon signaling pathway
    475495 (PGAM2)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    475495 (PGAM2)
Enzymes [BR:cfa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     475495 (PGAM2)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   475495 (PGAM2)
  Exosomal proteins of melanoma cells
   475495 (PGAM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 288 aa AA seqDB search
MPPGSWPGWGWGRPVIRPGAPGRQPSLRSPPRPGTMSTHRLVMVRHGESTWNQENRFCGW
FDAELSEKGAQEAARGAQAIKDAKMEFDICYTSVLKRAIRTLWTILDGTDQMWLPVVRTW
RLNERHYGGLTGLNKAETAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYGSISKERRYAGL
KPGELPTCESLKDTIARALPFWNEEIAPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAI
MELNLPTGIPIVYELDQALKPTKPMRFLGDEETVRKAMEAVAAQGKAK
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgccgcctggcagttggccggggtgggggtggggacggccggttataaggccgggcgcc
ccgggaaggcagccgtcccttcgcagcccgcctcgtcccggcaccatgtccacccaccgc
ctcgtgatggttcggcacggcgagagcacctggaaccaggagaaccgcttctgcggctgg
ttcgacgccgagctgagcgagaagggggcccaggaggctgcaaggggggcccaggccatc
aaggacgccaagatggagtttgacatctgctacacgtccgtgctgaagagggccatccgc
accctctggaccatcctggacggcacggaccagatgtggctgcccgtggtgcgcacctgg
cgcctcaacgagcgccactacgggggcctcaccggcctcaacaaggcggagacggccgcc
aagcacggggaggagcaggtgaagatctggaggcgctccttcgacatcccgccacccccc
atggatgagaagcacccctactacggctccatcagcaaggagcgccggtacgcgggcctg
aagcccggggagttgcccacttgcgagagcctgaaggacaccatcgcgcgggccctcccc
ttctggaacgaggagatcgccccccagatcaaggctggcaagcgagtgctcatcgcggcc
catgggaacagcctgcggggcattgtcaagcacctggaagggatgtccgaccaggccatc
atggagctgaacctacccacggggatccccatcgtgtatgagctggaccaggcgctgaag
cccaccaagcctatgcggttcctgggtgacgaggaaaccgtgcggaaggccatggaggct
gtggccgcccagggcaaggctaagtga

DBGET integrated database retrieval system