KEGG   Canis familiaris (dog): 475495Help
Entry
475495            CDS       T01007                                 

Gene name
PGAM2
Definition
phosphoglycerate mutase 2 (muscle)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cfa  Canis familiaris (dog)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:cfa01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cfa01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cfa00010]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:cfa00260]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
16
AA seq 288 aa AA seqDB search
MPPGSWPGWGWGRPVIRPGAPGRQPSLRSPPRPGTMSTHRLVMVRHGESTWNQENRFCGW
FDAELSEKGAQEAARGAQAIKDAKMEFDICYTSVLKRAIRTLWTILDGTDQMWLPVVRTW
RLNERHYGGLTGLNKAETAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYGSISKERRYAGL
KPGELPTCESLKDTIARALPFWNEEIAPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAI
MELNLPTGIPIVYELDQALKPTKPMRFLGDEETVRKAMEAVAAQGKAK
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgccgcctggcagttggccggggtgggggtggggacggccggttataaggccgggcgcc
ccgggaaggcagccgtcccttcgcagcccgcctcgtcccggcaccatgtccacccaccgc
ctcgtgatggttcggcacggcgagagcacctggaaccaggagaaccgcttctgcggctgg
ttcgacgccgagctgagcgagaagggggcccaggaggctgcaaggggggcccaggccatc
aaggacgccaagatggagtttgacatctgctacacgtccgtgctgaagagggccatccgc
accctctggaccatcctggacggcacggaccagatgtggctgcccgtggtgcgcacctgg
cgcctcaacgagcgccactacgggggcctcaccggcctcaacaaggcggagacggccgcc
aagcacggggaggagcaggtgaagatctggaggcgctccttcgacatcccgccacccccc
atggatgagaagcacccctactacggctccatcagcaaggagcgccggtacgcgggcctg
aagcccggggagttgcccacttgcgagagcctgaaggacaccatcgcgcgggccctcccc
ttctggaacgaggagatcgccccccagatcaaggctggcaagcgagtgctcatcgcggcc
catgggaacagcctgcggggcattgtcaagcacctggaagggatgtccgaccaggccatc
atggagctgaacctacccacggggatccccatcgtgtatgagctggaccaggcgctgaag
cccaccaagcctatgcggttcctgggtgacgaggaaaccgtgcggaaggccatggaggct
gtggccgcccagggcaaggctaagtga

DBGET integrated database retrieval system