KEGG   Canis familiaris (dog): 475495Help
Entry
475495            CDS       T01007                                 

Gene name
PGAM2
Definition
(RefSeq) phosphoglycerate mutase 2
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00010  Glycolysis / Gluconeogenesis
cfa00260  Glycine, serine and threonine metabolism
cfa01100  Metabolic pathways
cfa01200  Carbon metabolism
cfa01230  Biosynthesis of amino acids
cfa04922  Glucagon signaling pathway
cfa05230  Central carbon metabolism in cancer
Module
cfa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cfa_M00002  Glycolysis, core module involving three-carbon compounds
cfa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    475495 (PGAM2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    475495 (PGAM2)
 Organismal Systems
  Endocrine system
   04922 Glucagon signaling pathway
    475495 (PGAM2)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    475495 (PGAM2)
Enzymes [BR:cfa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     475495 (PGAM2)
Membrane trafficking [BR:cfa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    475495 (PGAM2)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   475495 (PGAM2)
  Exosomal proteins of melanoma cells
   475495 (PGAM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 475495
NCBI-ProteinID: XP_532718
Ensembl: ENSCAFG00000002877
Position
Un
AA seq 288 aa AA seqDB search
MPPGSWPGWGWGRPVIRPGAPGRQPSLRSPPRPGTMSTHRLVMVRHGESTWNQENRFCGW
FDAELSEKGAQEAARGAQAIKDAKMEFDICYTSVLKRAIRTLWTILDGTDQMWLPVVRTW
RLNERHYGGLTGLNKAETAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYGSISKERRYAGL
KPGELPTCESLKDTIARALPFWNEEIAPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAI
MELNLPTGIPIVYELDQALKPTKPMRFLGDEETVRKAMEAVAAQGKAK
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgccgcctggcagttggccggggtgggggtggggacggccggttataaggccgggcgcc
ccgggaaggcagccgtcccttcgcagcccgcctcgtcccggcaccatgtccacccaccgc
ctcgtgatggttcggcacggcgagagcacctggaaccaggagaaccgcttctgcggctgg
ttcgacgccgagctgagcgagaagggggcccaggaggctgcaaggggggcccaggccatc
aaggacgccaagatggagtttgacatctgctacacgtccgtgctgaagagggccatccgc
accctctggaccatcctggacggcacggaccagatgtggctgcccgtggtgcgcacctgg
cgcctcaacgagcgccactacgggggcctcaccggcctcaacaaggcggagacggccgcc
aagcacggggaggagcaggtgaagatctggaggcgctccttcgacatcccgccacccccc
atggatgagaagcacccctactacggctccatcagcaaggagcgccggtacgcgggcctg
aagcccggggagttgcccacttgcgagagcctgaaggacaccatcgcgcgggccctcccc
ttctggaacgaggagatcgccccccagatcaaggctggcaagcgagtgctcatcgcggcc
catgggaacagcctgcggggcattgtcaagcacctggaagggatgtccgaccaggccatc
atggagctgaacctacccacggggatccccatcgtgtatgagctggaccaggcgctgaag
cccaccaagcctatgcggttcctgggtgacgaggaaaccgtgcggaaggccatggaggct
gtggccgcccagggcaaggctaagtga

DBGET integrated database retrieval system