KEGG   Canis familiaris (dog): 475506Help
Entry
475506            CDS       T01007                                 

Gene name
NUP205
Definition
(RefSeq) nucleoporin 205kDa
  KO
K14310  
nuclear pore complex protein Nup205
Organism
cfa  Canis familiaris (dog)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    475506 (NUP205)
Messenger RNA biogenesis [BR:cfa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     475506 (NUP205)
Chromosome [BR:cfa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    475506 (NUP205)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
16
AA seq 1972 aa AA seqDB search
MILKKHKPDFISLFRNPPKNVQQHEKVQKASTEGVAIQGQQGTRLLPEQLIKEAFILSDL
FDIGELAAVELLLAGEHQQPHFPGLTRGLVAVLLYWDGKRCIANSLKALIQSRRGKTWTL
ELSPELVSMTTRFTEELMEQGLTYKVLTLVSQIDVNNEFEKLQRERGLGSEKHRKEVSDL
IKECRQSLAESLFAWACQSPLGKDDTLLLIGHLEKVTVEANGSLDAVNLALLMALLYCFD
ISFLEQSTEERDDMIHQLPLLTERQYIATIHSRLQDSQLWKLPGLQATVRLAWALALRGI
SQLPDVTALAEFTEADEAMAELAIADNVFLFLTESVVVSENFYQEEFYIRRIHNLITDFL
ALMPMKVKQLRNRADEDARIIHMSMQMGNEPPISLRRDLEHLMLLIGELYKKNPFNLELA
LEYWCPSEPLQTSTIMGSYLGVAHQRPPQRQVVLSKFVRQMGDLLPPTIYIPYLKMLQGL
ANGPQCAHYCFSLLKVNGSSHVENIQGTGGSPVSWEHFFHSLMLYHEHLRKDLPSADSVQ
YRHLPSRGITQKEQDGLIAFLQLTSTIITWSENARLALCEHPQWTPVVVILGLLQCSIPP
VLKAELLKTLAAFGKSPEIAASLWQSLEYTQILQTVRVPSQRQAIGIEVELNEIESRCEE
YPLTRAFCQLISTLVESSFPSNLGAGLRPPGFDPYLQFLRDSVFLRFRTRAYRRAAEKWE
VAEVVLEVFYKLLRDYEPQLEDFVDQFVELQGEEIIAYKPPGFSLMYHLLNESPMLELAL
SLLEEGVKQLDTYAPFPGKKHLEKAVQHCLALLNLTLQKENLFMDLLRESQLALIVSPLE
QLLQGINPRTKKADNVVNIARYLYHGNTNSELAFESAKILCCISCNSNIQIKLVGDFTHD
QSVSQKLMAGFVECLDSEDTEEFVRLEEGSELEKKLAGIRHETRIHILNLLITSLERNPP
NLALYLLGFELKKPVSTTNLQDPGVLGCPRTCLHAILNILEKGTEGRTGPVAVRESPQLA
ELCYQVIYQLCACADTSGPTMRYLRTSQDFLFSQLQHLPFSNKEYEMSMLNQMSWLMKTA
SIELRVTSLNRQRSHTQRLLHLLLDDMPVKPYSDGEGGIEDENRSVSGFLHFDTTTKVRR
KILSILDSIDFSQEIPEPLQLDFFDRTQIEQVIANCEHKNLRGQTVCNVKLLHRVLVAEV
NALQGMAAIGQRPLLMEEISTILQYVVGRNKLLQCLHAKRHVLESWRQLVEIILTACPQD
LIQAEDRQLIIRDILQDVHDKILDDEAAQELMPVVAGAVFTLTAHLSQAVRTEQKQPLVL
GPGETHYAFMLDSSFTSPPPAENPMVGFASIGDSSLHIILKKLLDFILKTGGGFQRVRTH
LYGSLLYYLQIAQRPDEPDTLEAAKKTMWERLTAPEDVFSKLQRENIAIIESYGAALMEV
VCRDACDGHEIGRMLALALLDRIVSVDKQQQWLLYLSNSGYLKVLVDSLVEDDHTLQSLL
TPQPPLLKALYTYESKMAFLTRVAKIQQGALELLRSGVIVRLAQCQVYDMRPEMDPQGMF
GMRDPPVFIPAPVDRYRQILLPALRLCQVILTSSTAQHLQAAGQVLQFLISHSDTIQAIL
RCQDVSAGSLQELALLTGIISKAALPGILSELDVDVNEGSLMELQGHIGRFQRQCLGLLS
RFGGSDRLRQFKFQDENVEGDRVSKKDELELAMQQICANVMEYCQSLMLQSSPTFQHAMC
LFTPSLSETINRDGPRQDTQAPVIPYWRLPGLGIIVYLLKQSANDFFSYYDSHRRSVNKL
QNVEQLPPDEIKELCQSVMPVGVEKISTAQKYVLARRRLVKLINNRAKLLSLCSFIIETC
LFILWRHLEYYLLHCTPTDSQDSLFASRTLFKSRRLQDSFTSETNLDFRSGLTGVSQHDL
DQLQADAINAFGESLQKKLLDIEGLYSKVRSRYSFIQALVRRIRGLLRISRN
NT seq 5919 nt NT seq  +upstreamnt  +downstreamnt
atgattttgaagaaacacaaacctgatttcatctcactcttcagaaacccacccaaaaat
gtccaacaacatgagaaggttcagaaagccagtacagagggagtcgctatccagggtcaa
cagggaacccgacttcttcctgaacagctcattaaagaggcctttatccttagtgacctt
tttgatattggagaattggcagctgttgagcttctcctcgctggagagcaccaacagcca
cattttcctggtctcaccagaggattagtagctgttcttttatattgggatggaaaacgg
tgcattgcaaattccctgaaagccttaatacagtctagacgaggaaagacgtggaccctt
gaactcagtccagagctggtttccatgacaacacggtttacagaggagctgatggagcaa
ggattgacttataaagtccttactctggtgtcacagattgatgtgaacaatgagtttgaa
aaactacagcgggagagaggtttgggcagtgaaaaacatcgaaaagaggtttctgatctc
atcaaggagtgcaggcagtctctggcagaaagcctttttgcctgggcttgtcagtcacct
ttaggcaaagatgacactctgcttcttattggacatttggaaaaagtgacagttgaggct
aatggctccttggatgcagtgaatctggctcttcttatggcgcttctatactgctttgat
atcagttttctagaacaaagcacagaggaacgagatgatatgattcatcaacttccactg
ttgacagaaagacaatacattgcaacaattcactctcgcctacaagactcacagctttgg
aaactgcctggcctgcaggccactgttagacttgcctgggcactggcattgagaggaata
tctcagctacctgatgtgacagctctggctgaatttacagaagcggatgaagcaatggca
gagctcgcaattgctgacaatgtcttcctgttcctcactgaatccgtagtggtgtcagaa
aacttctatcaggaggagttttatattcgtagaatccataatctcatcacagatttcctg
gcgcttatgccaatgaaggtgaaacagttgaggaatcgggcagatgaagatgctcgaata
attcacatgagtatgcagatgggtaatgaacctcccatttcacttagaagagatctggaa
cacttaatgctcttgattggtgagctatataaaaagaatccttttaatttggagcttgct
ctcgaatattggtgtccctcagagcctcttcagacttccactatcatgggttcttacctt
ggggtggctcatcagcgaccccctcaacgccaggttgttttgtcaaagtttgttaggcaa
atgggtgacctattgcctccaacgatatacattccgtatttgaaaatgcttcagggattg
gctaatgggccccagtgcgcccactactgtttcagcctgcttaaagtcaatggtagtagt
catgttgaaaatattcagggaacaggtggcagtcctgtttcctgggaacatttctttcac
tccttaatgctttaccatgagcacctccggaaggatcttccaagtgcagatagtgtccag
taccggcaccttccttcccgtggaatcacccagaaggaacaggatggattgattgctttt
ttacagctcacctccaccatcattacttggagtgaaaatgctcgcctggcactctgtgaa
catcctcagtggaccccggttgtggtgattctgggactcctacaatgcagtattcccccc
gttcttaaagcagagctgctgaagacccttgcagcttttggaaaatctcctgaaattgct
gcttccctctggcagtccctggaatacactcagatactgcaaaccgtaagggttccaagc
cagaggcaagctattggtatcgaggttgaactaaatgaaatagaatcccggtgtgaagaa
tacccattgactcgagctttttgccagcttattagtaccttggtggagagttcatttcct
tctaatttgggtgctggcctgcggccccctggctttgacccttatttgcagttcctcaga
gattctgtgtttctccgattccgcacgagagcttaccggagagcagctgaaaagtgggaa
gttgctgaggttgttttggaggtgttttataaattgctcagagattatgagcctcaactt
gaagattttgtagaccagtttgtggaattacaaggagaagaaatcatagcctacaagcca
ccaggatttagtctcatgtatcatcttctgaatgagtcaccaatgttggagcttgctctt
agtttattggaagaaggcgttaagcagctggatacctatgcccctttccctgggaagaaa
cacttggagaaagcagtgcagcattgccttgcacttctcaatctgactctgcaaaaggaa
aatctctttatggaccttctaagagagagtcagctggctctaatagtttctcctctagaa
cagttgttacagggaatcaatcccagaaccaagaaggctgataatgtggtgaatattgcc
agatacctgtatcatggcaacactaattcagaattggcttttgaaagtgccaagatcctc
tgctgtatctcttgcaactctaatattcagataaaattggttggagatttcacacatgac
cagagtgtaagtcagaagctgatggctggatttgtggagtgtttggatagtgaagataca
gaagaatttgtacgcctagaagagggatcagagcttgagaagaagttagctggaatccgt
catgaaacaagaatccacatcctgaatcttctcatcacctctctggaacgcaacccaccc
aatcttgctctctacctgctgggatttgaactgaagaaacctgtcagtaccacaaaccta
caagatccaggagtgttaggttgccctcggacgtgccttcatgccattttaaacatcttg
gagaaaggaaccgaagggagaacaggcccggtggcagtgagagagtctcctcaactcgct
gaactatgttaccaggtgatatatcagttgtgtgcatgcgcagatacatctggtcctact
atgaggtacttgagaaccagccaggatttcttattttctcagttacaacatttacctttt
tctaacaaagaatatgaaatgtctatgctgaaccagatgtcatggctaatgaagactgcc
tcaatagaactaagggtaacttctctgaatcgtcaacgctcacatacccagaggctccta
cacctcctactggatgacatgcctgtgaaaccatattcagatggtgaaggaggaatagaa
gatgaaaacaggtctgtctcaggattccttcactttgatactactacaaaagtacgccga
aaaattctaagtattctggactcgattgacttcagtcaggagatccctgagcctttgcag
ttggatttctttgatcggacccagatcgagcaagttattgctaactgtgaacacaagaat
ttacggggacagacagtctgcaatgtcaagcttcttcatagggttcttgtagctgaagta
aatgctcttcagggtatggcagccataggacagagaccgctattaatggaggaaattagc
accatacttcagtatgtggtaggaagaaacaaattgctgcagtgtcttcatgcaaaacgg
catgtgctagagtcatggaggcagctggtggaaattatactgacagcttgtcctcaggac
ctcattcaggcagaggatcgacaactgattattcgtgatattttacaagatgtgcatgat
aagatactggatgatgaagcagcacaagagttaatgccggtggtggcaggtgctgtgttc
accctgactgctcacctaagccaagccgttcgcacagaacagaagcaaccattagttttg
ggacccggagagacccattatgcttttatgcttgatagttctttcacctcccctcctcca
gcagagaacccaatggtgggttttgcttctattggagattcttcgcttcacatcatattg
aagaagctcttggacttcattttgaagacaggtggcggattccaacgagtgaggacacac
ctgtacggctctctgttgtattacttacagattgcccagagaccagatgaaccagataca
ctagaagcagccaagaaaaccatgtgggaaaggctgacagcccctgaagatgtatttagt
aaattacagcgagaaaacatagccatcattgagagctatggcgctgccctcatggaagtg
gtctgtcgagatgcttgtgatggtcacgagattggaaggatgctggcactggctctactt
gatcggattgtctccgtagataagcagcagcagtggcttttgtatctttctaacagtggc
tatttgaaggtgcttgtggacagcttggtagaagatgaccatactttgcagagcttacta
actccacaacctccccttttaaaagctctttatacgtacgaatccaaaatggcatttctt
acaagagtggctaagatacagcagggtgcactagagctgctgaggtctggggtgatagtg
agactggcacaatgtcaggtctatgacatgcgcccagagatggacccacagggcatgttc
ggcatgagagacccgccagtgttcatccctgcccctgtggaccgctaccggcagattctg
ctcccggctctccgcttgtgccaggtcatcctcacatccagcactgcccagcacttacag
gcagcagggcaggtgttgcagtttctcatttcacattctgataccatacaagcaatcctg
cgctgtcaggatgtgagtgctgggtctttgcaggaactggctctgctgacgggaattata
agtaaagcagcacttcctggtatattaagtgaacttgatgttgatgtaaatgaaggatct
ctaatggaactacagggacatattggaagattccagcgccagtgtttaggactactaagc
cgctttggaggctctgacagactgcgccagtttaaatttcaagatgaaaacgtggaggga
gatagagtgagcaagaaagatgaactcgaactggccatgcagcagatctgtgccaatgtc
atggaatattgccagtcactcatgttacagagctcccccacattccagcatgccatgtgt
ctcttcaccccgagcctgtcagaaaccattaacagagacggacctcggcaagatacccaa
gctccagtgattccatattggcgcctgccaggtttgggcattattgtctacctgctgaaa
cagagcgctaatgatttcttcagctattatgacagtcaccgacggagtgtcaacaagcta
cagaatgtagagcagcttccaccagatgagataaaagagttgtgtcagtctgtgatgcct
gttggtgttgagaaaatctctactgcccagaaatatgttctagcaagacggcgtttggtg
aagttgatcaataatcgagccaaactgctttccctctgttcttttatcatagagacctgc
ctatttattctttggcgccatctggagtactacttgttacactgcacgcccacagattct
caagattccttgtttgcctccagaaccttatttaaaagcagaagactacaagattccttc
acttcagaaaccaacctagattttagaagtggactgacaggagtgagccaacatgactta
gaccagcttcaggctgatgccatcaacgcttttggagaatcactacaaaagaaacttctg
gacattgaaggattgtactcaaaagttcgatctcgctatagtttcatacaagctctagtc
agacgtatccgaggcctgctgaggatatcaaggaactga

DBGET integrated database retrieval system