KEGG   Canis familiaris (dog): 475506Help
Entry
475506            CDS       T01007                                 

Gene name
NUP205
Definition
(RefSeq) nucleoporin 205
  KO
K14310  nuclear pore complex protein Nup205
Organism
cfa  Canis familiaris (dog)
Pathway
cfa03013  RNA transport
Module
cfa_M00427  Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    475506 (NUP205)
Messenger RNA biogenesis [BR:cfa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     475506 (NUP205)
Chromosome and associated proteins [BR:cfa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    475506 (NUP205)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nup192
Motif
Other DBs
NCBI-GeneID: 475506
NCBI-ProteinID: XP_013975409
Ensembl: ENSCAFG00000003235
Position
16
AA seq 1972 aa AA seqDB search
MILKKHKPDFISLFRNPPKNVQQHEKVQKASTEGVAIQGQQGTRLLPEQLIKEAFILSDL
FDIGELAAVELLLAGEHQQPHFPGLTRGLVAVLLYWDGKRCIANSLKALIQSRRGKTWTL
ELSPELVSMTTRFTEELMEQGLTYKVLTLVSQIDVNNEFEKLQRERGLGSEKHRKEVSDL
IKECRQSLAESLFAWACQSPLGKDDTLLLIGHLEKVTVEANGSLDAVNLALLMALLYCFD
ISFLEQSTEERDDMIHQLPLLTERQYIATIHSRLQDSQLWKLPGLQATVRLAWALALRGI
SQLPDVTALAEFTEADEAMAELAIADNVFLFLTESVVVSENFYQEEFYIRRIHNLITDFL
ALMPMKVKQLRNRADEDARIIHMSMQMGNEPPISLRRDLEHLMLLIGELYKKNPFNLELA
LEYWCPSEPLQTSTIMGSYLGVAHQRPPQRQVVLSKFVRQMGDLLPPTIYIPYLKMLQGL
ANGPQCAHYCFSLLKVNGSSHVENIQGTGGSPVSWEHFFHSLMLYHEHLRKDLPSADSVQ
YRHLPSRGITQKEQDGLIAFLQLTSTIITWSENARLALCEHPQWTPVVVILGLLQCSIPP
VLKAELLKTLAAFGKSPEIAASLWQSLEYTQILQTVRVPSQRQAIGIEVELNEIESRCEE
YPLTRAFCQLISTLVESSFPSNLGAGLRPPGFDPYLQFLRDSVFLRFRTRAYRRAAEKWE
VAEVVLEVFYKLLRDYEPQLEDFVDQFVELQGEEIIAYKPPGFSLMYHLLNESPMLELAL
SLLEEGVKQLDTYAPFPGKKHLEKAVQHCLALLNLTLQKENLFMDLLRESQLALIVSPLE
QLLQGINPRTKKADNVVNIARYLYHGNTNSELAFESAKILCCISCNSNIQIKLVGDFTHD
QSVSQKLMAGFVECLDSEDTEEFVRLEEGSELEKKLAGIRHETRIHILNLLITSLERNPP
NLALYLLGFELKKPVSTTNLQDPGVLGCPRTCLHAILNILEKGTEGRTGPVAVRESPQLA
ELCYQVIYQLCACADTSGPTMRYLRTSQDFLFSQLQHLPFSNKEYEMSMLNQMSWLMKTA
SIELRVTSLNRQRSHTQRLLHLLLDDMPVKPYSDGEGGIEDENRSVSGFLHFDTTTKVRR
KILSILDSIDFSQEIPEPLQLDFFDRTQIEQVIANCEHKNLRGQTVCNVKLLHRVLVAEV
NALQGMAAIGQRPLLMEEISTILQYVVGRNKLLQCLHAKRHVLESWRQLVEIILTACPQD
LIQAEDRQLIIRDILQDVHDKILDDEAAQELMPVVAGAVFTLTAHLSQAVRTEQKQPLVL
GPGETHYAFMLDSSFTSPPPAENPMVGFASIGDSSLHIILKKLLDFILKTGGGFQRVRTH
LYGSLLYYLQIAQRPDEPDTLEAAKKTMWERLTAPEDVFSKLQRENIAIIESYGAALMEV
VCRDACDGHEIGRMLALALLDRIVSVDKQQQWLLYLSNSGYLKVLVDSLVEDDHTLQSLL
TPQPPLLKALYTYESKMAFLTRVAKIQQGALELLRSGVIVRLAQCQVYDMRPEMDPQGMF
GMRDPPVFIPAPVDRYRQILLPALRLCQVILTSSTAQHLQAAGQVLQFLISHSDTIQAIL
RCQDVSAGSLQELALLTGIISKAALPGILSELDVDVNEGSLMELQGHIGRFQRQCLGLLS
RFGGSDRLRQFKFQDENVEGDRVSKKDELELAMQQICANVMEYCQSLMLQSSPTFQHAMC
LFTPSLSETINRDGPRQDTQAPVIPYWRLPGLGIIVYLLKQSANDFFSYYDSHRRSVNKL
QNVEQLPPDEIKELCQSVMPVGVEKISTAQKYVLARRRLVKLINNRAKLLSLCSFIIETC
LFILWRHLEYYLLHCTPTDSQDSLFASRTLFKSRRLQDSFTSETNLDFRSGLTGVSQHDL
DQLQADAINAFGESLQKKLLDIEGLYSKVRSRYSFIQALVRRIRGLLRISRN
NT seq 5919 nt NT seq  +upstreamnt  +downstreamnt
atgattttgaagaaacacaaacctgatttcatctcactcttcagaaacccacccaaaaat
gtccaacaacatgagaaggttcagaaagccagtacagagggagtcgctatccagggtcaa
cagggaacccgacttcttcctgaacagctcattaaagaggcctttatccttagtgacctt
tttgatattggagaattggcagctgttgagcttctcctcgctggagagcaccaacagcca
cattttcctggtctcaccagaggattagtagctgttcttttatattgggatggaaaacgg
tgcattgcaaattccctgaaagccttaatacagtctagacgaggaaagacgtggaccctt
gaactcagtccagagctggtttccatgacaacacggtttacagaggagctgatggagcaa
ggattgacttataaagtccttactctggtgtcacagattgatgtgaacaatgagtttgaa
aaactacagcgggagagaggtttgggcagtgaaaaacatcgaaaagaggtttctgatctc
atcaaggagtgcaggcagtctctggcagaaagcctttttgcctgggcttgtcagtcacct
ttaggcaaagatgacactctgcttcttattggacatttggaaaaagtgacagttgaggct
aatggctccttggatgcagtgaatctggctcttcttatggcgcttctatactgctttgat
atcagttttctagaacaaagcacagaggaacgagatgatatgattcatcaacttccactg
ttgacagaaagacaatacattgcaacaattcactctcgcctacaagactcacagctttgg
aaactgcctggcctgcaggccactgttagacttgcctgggcactggcattgagaggaata
tctcagctacctgatgtgacagctctggctgaatttacagaagcggatgaagcaatggca
gagctcgcaattgctgacaatgtcttcctgttcctcactgaatccgtagtggtgtcagaa
aacttctatcaggaggagttttatattcgtagaatccataatctcatcacagatttcctg
gcgcttatgccaatgaaggtgaaacagttgaggaatcgggcagatgaagatgctcgaata
attcacatgagtatgcagatgggtaatgaacctcccatttcacttagaagagatctggaa
cacttaatgctcttgattggtgagctatataaaaagaatccttttaatttggagcttgct
ctcgaatattggtgtccctcagagcctcttcagacttccactatcatgggttcttacctt
ggggtggctcatcagcgaccccctcaacgccaggttgttttgtcaaagtttgttaggcaa
atgggtgacctattgcctccaacgatatacattccgtatttgaaaatgcttcagggattg
gctaatgggccccagtgcgcccactactgtttcagcctgcttaaagtcaatggtagtagt
catgttgaaaatattcagggaacaggtggcagtcctgtttcctgggaacatttctttcac
tccttaatgctttaccatgagcacctccggaaggatcttccaagtgcagatagtgtccag
taccggcaccttccttcccgtggaatcacccagaaggaacaggatggattgattgctttt
ttacagctcacctccaccatcattacttggagtgaaaatgctcgcctggcactctgtgaa
catcctcagtggaccccggttgtggtgattctgggactcctacaatgcagtattcccccc
gttcttaaagcagagctgctgaagacccttgcagcttttggaaaatctcctgaaattgct
gcttccctctggcagtccctggaatacactcagatactgcaaaccgtaagggttccaagc
cagaggcaagctattggtatcgaggttgaactaaatgaaatagaatcccggtgtgaagaa
tacccattgactcgagctttttgccagcttattagtaccttggtggagagttcatttcct
tctaatttgggtgctggcctgcggccccctggctttgacccttatttgcagttcctcaga
gattctgtgtttctccgattccgcacgagagcttaccggagagcagctgaaaagtgggaa
gttgctgaggttgttttggaggtgttttataaattgctcagagattatgagcctcaactt
gaagattttgtagaccagtttgtggaattacaaggagaagaaatcatagcctacaagcca
ccaggatttagtctcatgtatcatcttctgaatgagtcaccaatgttggagcttgctctt
agtttattggaagaaggcgttaagcagctggatacctatgcccctttccctgggaagaaa
cacttggagaaagcagtgcagcattgccttgcacttctcaatctgactctgcaaaaggaa
aatctctttatggaccttctaagagagagtcagctggctctaatagtttctcctctagaa
cagttgttacagggaatcaatcccagaaccaagaaggctgataatgtggtgaatattgcc
agatacctgtatcatggcaacactaattcagaattggcttttgaaagtgccaagatcctc
tgctgtatctcttgcaactctaatattcagataaaattggttggagatttcacacatgac
cagagtgtaagtcagaagctgatggctggatttgtggagtgtttggatagtgaagataca
gaagaatttgtacgcctagaagagggatcagagcttgagaagaagttagctggaatccgt
catgaaacaagaatccacatcctgaatcttctcatcacctctctggaacgcaacccaccc
aatcttgctctctacctgctgggatttgaactgaagaaacctgtcagtaccacaaaccta
caagatccaggagtgttaggttgccctcggacgtgccttcatgccattttaaacatcttg
gagaaaggaaccgaagggagaacaggcccggtggcagtgagagagtctcctcaactcgct
gaactatgttaccaggtgatatatcagttgtgtgcatgcgcagatacatctggtcctact
atgaggtacttgagaaccagccaggatttcttattttctcagttacaacatttacctttt
tctaacaaagaatatgaaatgtctatgctgaaccagatgtcatggctaatgaagactgcc
tcaatagaactaagggtaacttctctgaatcgtcaacgctcacatacccagaggctccta
cacctcctactggatgacatgcctgtgaaaccatattcagatggtgaaggaggaatagaa
gatgaaaacaggtctgtctcaggattccttcactttgatactactacaaaagtacgccga
aaaattctaagtattctggactcgattgacttcagtcaggagatccctgagcctttgcag
ttggatttctttgatcggacccagatcgagcaagttattgctaactgtgaacacaagaat
ttacggggacagacagtctgcaatgtcaagcttcttcatagggttcttgtagctgaagta
aatgctcttcagggtatggcagccataggacagagaccgctattaatggaggaaattagc
accatacttcagtatgtggtaggaagaaacaaattgctgcagtgtcttcatgcaaaacgg
catgtgctagagtcatggaggcagctggtggaaattatactgacagcttgtcctcaggac
ctcattcaggcagaggatcgacaactgattattcgtgatattttacaagatgtgcatgat
aagatactggatgatgaagcagcacaagagttaatgccggtggtggcaggtgctgtgttc
accctgactgctcacctaagccaagccgttcgcacagaacagaagcaaccattagttttg
ggacccggagagacccattatgcttttatgcttgatagttctttcacctcccctcctcca
gcagagaacccaatggtgggttttgcttctattggagattcttcgcttcacatcatattg
aagaagctcttggacttcattttgaagacaggtggcggattccaacgagtgaggacacac
ctgtacggctctctgttgtattacttacagattgcccagagaccagatgaaccagataca
ctagaagcagccaagaaaaccatgtgggaaaggctgacagcccctgaagatgtatttagt
aaattacagcgagaaaacatagccatcattgagagctatggcgctgccctcatggaagtg
gtctgtcgagatgcttgtgatggtcacgagattggaaggatgctggcactggctctactt
gatcggattgtctccgtagataagcagcagcagtggcttttgtatctttctaacagtggc
tatttgaaggtgcttgtggacagcttggtagaagatgaccatactttgcagagcttacta
actccacaacctccccttttaaaagctctttatacgtacgaatccaaaatggcatttctt
acaagagtggctaagatacagcagggtgcactagagctgctgaggtctggggtgatagtg
agactggcacaatgtcaggtctatgacatgcgcccagagatggacccacagggcatgttc
ggcatgagagacccgccagtgttcatccctgcccctgtggaccgctaccggcagattctg
ctcccggctctccgcttgtgccaggtcatcctcacatccagcactgcccagcacttacag
gcagcagggcaggtgttgcagtttctcatttcacattctgataccatacaagcaatcctg
cgctgtcaggatgtgagtgctgggtctttgcaggaactggctctgctgacgggaattata
agtaaagcagcacttcctggtatattaagtgaacttgatgttgatgtaaatgaaggatct
ctaatggaactacagggacatattggaagattccagcgccagtgtttaggactactaagc
cgctttggaggctctgacagactgcgccagtttaaatttcaagatgaaaacgtggaggga
gatagagtgagcaagaaagatgaactcgaactggccatgcagcagatctgtgccaatgtc
atggaatattgccagtcactcatgttacagagctcccccacattccagcatgccatgtgt
ctcttcaccccgagcctgtcagaaaccattaacagagacggacctcggcaagatacccaa
gctccagtgattccatattggcgcctgccaggtttgggcattattgtctacctgctgaaa
cagagcgctaatgatttcttcagctattatgacagtcaccgacggagtgtcaacaagcta
cagaatgtagagcagcttccaccagatgagataaaagagttgtgtcagtctgtgatgcct
gttggtgttgagaaaatctctactgcccagaaatatgttctagcaagacggcgtttggtg
aagttgatcaataatcgagccaaactgctttccctctgttcttttatcatagagacctgc
ctatttattctttggcgccatctggagtactacttgttacactgcacgcccacagattct
caagattccttgtttgcctccagaaccttatttaaaagcagaagactacaagattccttc
acttcagaaaccaacctagattttagaagtggactgacaggagtgagccaacatgactta
gaccagcttcaggctgatgccatcaacgcttttggagaatcactacaaaagaaacttctg
gacattgaaggattgtactcaaaagttcgatctcgctatagtttcatacaagctctagtc
agacgtatccgaggcctgctgaggatatcaaggaactga

DBGET integrated database retrieval system