KEGG   Canis familiaris (dog): 475684Help
Entry
475684            CDS       T01007                                 

Gene name
NCOA1, SRC1
Definition
nuclear receptor coactivator 1
Orthology
K09101  
nuclear receptor coactivator 1 [EC:2.3.1.48]
Organism
cfa  Canis familiaris (dog)
Pathway
Thyroid hormone signaling pathway
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    475684 (NCOA1)
Enzymes [BR:cfa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     475684 (NCOA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
17
AA seq 1440 aa AA seqDB search
MSGLGDSSSDPANPDSHKRKGSPCDTLASSTEKRRREQENKYLEELAELLSANISDIDSL
SVKPDKCKILKKTVDQIQLMKRMEQEKSTTDDEVQKSDISSSSQGVIEKESLGPLLLEAL
DGFFFVVNCEGRIVFVSENVTSYLGYNQEELMNTSVYSILHVGDHAEFVKNLLPKSLVNG
VPWPQEATRRNSHTFNCRMLIHPPDEPGTENQEACQRYEVMQCFTVSQPKSIQEDGEDFQ
SCLICIARRLPRPPAITGVESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFF
QPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTKCKLCYPQSPDMQPFIMG
IHIIDREHSGLSPQDDTNSGMSIPRVNPSVNSSISPAHGVARSSTLPPSSNNMVSPRVNR
QQSSDLHSSSHSNSSNSQGSFGCSPGNQIVASVALNQGQASSQSTNPSLNLNNSPMEGTG
ISLAQFMSPRRQVSSGLAPRPRMPNNSFPPNIPTLSSPVSMTGTACNNSNRSYSNIPVTS
LQSMNEGPNNSVGFSASSPVLRQMSSQNSPSRLNIQPAKAESKDNKEIASILNEMIQSDN
SSTDGKPLDSGLLHNNDRLSEGDNKYSQTSHKLVQLLTTTAEQQLRHADIDTSCKEVLSC
SGTSNSASANSSSGSCPSSHSSLTERHKILHRLLQEGSPSDITTLSVEPDKKDGASTSVS
VTGQVQGNSSVKLELDASKKKESKDHQLLRYLLDKDEKDLRSTPNLSLDDVKVKVEKKEQ
MDPCTTNPTPMTKPAPEEIKLESQSQFTADLDQFDQLLPTLEKAAQLPGLCEPERMDGAV
TNVTIKSETLPASLQSTTARPTSRLNRLPELELEAIDNQFGQPGTGDQIPWANNTVTAVN
QNKPEDQCISSQLDELLCPPTTVEGRNDEKALLEQLVSFLSGKDETELAELDRALGIDKL
VQGGGLDVLSERFPPQQATPPLMMEERPNLYSQPYSSPSPTANLSSPFQGMVRQKPSLGT
MPVQVTPPRGAFSPGMGMQPRQTLNRPPAAPNQLRLQLQQRLQGQQQLIHQNRQAILNQF
AANAPVGINMRSGMQQQITPQPPLNAQMLAQRQRELYSQQHRQRQLIQQQRAMLMRQQSF
GNNLPPSSGLPVQMGNPRLPQGAPQQFPYPPSYGTNPGTPPASTSPFSQLAANPESTLAN
RNSMVNRGMAGNMGGQFGTGINPQMQQNVFQYPGSGMVPQGEANFAPSLSPGNSMVPMPI
PPPQSSLLQPTPPSSGYQSPDMKAWQPGAMGNNVFSQAVQNQPTPAQPGVYNNMSITVSM
AGGNTNVQNMNPMMGQMQMSSLQMPGMNTVCPEQINDPALRHTGLYCNQLSSTDLLKTET
DGTQQVQQVQVFADVQCTVNLVGGDPYLNQPGPLGTQKPTAGPQTPQAQQKSLLQQLLTE
NT seq 4323 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcctcggggacagttcatccgaccctgctaacccagattcacataagaggaaa
ggatcgccatgtgacactctggcatcaagcactgaaaagagacgcagggagcaagaaaat
aaatatttagaagagctagctgagttactatctgccaacatcagtgacattgacagtttg
agtgtaaaaccagacaaatgcaagattttgaagaagacagtcgatcagatacagttaatg
aagagaatggaacaagagaaatccacaactgatgatgaagtgcagaaatcagacatctca
tcgagcagtcagggagtgatagaaaaggagtccctgggacctctcctgttggaggctttg
gatggatttttctttgttgtgaactgtgaagggagaattgtatttgtgtcagagaatgtg
accagctacttgggttacaatcaggaggaattaatgaataccagtgtctacagcatactg
catgtaggggatcatgcagaatttgtgaagaatctgctaccaaaatcactagtaaatgga
gttccttggcctcaggaggcaacacgacgaaatagccatacctttaactgcaggatgcta
attcaccctccagatgagccaggcactgagaaccaagaagcttgccagcggtacgaagtc
atgcagtgtttcaccgtgtcacagccaaaatcaattcaagaggatggagaagatttccag
tcatgtttgatttgtattgcacggcgattacctcggcctccagccattacaggtgtagaa
tcctttatgaccaagcaagatactacaggtaaaatcatctctattgatactagctccctg
agagctgctggaagaactggctgggaagatttagtgaggaagtgcatttatgcttttttc
caacctcagggcagagaaccatcttatgccagacaactatttcaagaagtgatgactcgt
ggcactgcctccagcccatcctatagattcatattgaatgatgggacaatgcttagcgcc
cacaccaagtgtaaactttgctaccctcaaagtccagacatgcaacctttcatcatggga
attcatatcatcgacagggaacacagtggtctttctcctcaagatgacactaattctgga
atgtcaattccccgagtaaacccctccgtcaattctagtatctcgccagctcatggtgtg
gcccgttcatccacattgccaccatccagcaacaacatggtgtcccccagagtaaaccgc
caacagagctcagacctccatagcagcagtcatagtaattctagcaacagccaagggagt
tttggatgctcacctggaaatcagattgtagccagtgttgccttaaaccagggacaggcc
agttcccagagcactaacccctctttaaacctcaataattctcctatggaaggtacagga
atatctctcgcacagttcatgtctccaaggagacaagttagttctggattagcaccaagg
cccaggatgccaaacaattcgttccctcctaatattccgacattaagctcccccgttagc
atgacaggtactgcctgtaataatagtaaccgatcctattcaaacatcccagtaacatct
ttacagagcatgaatgaaggacccaataactctgttggcttctctgccagttctccagtc
ctcaggcagatgagctcacagaattcacctagcaggttaaatatacaaccagcaaaagct
gagtccaaagataacaaagagattgcatccattttaaatgaaatgattcagtctgacaac
agctctactgatggcaaacctctggattctgggcttctgcataacaatgacagactctca
gaaggagacaataagtactctcaaaccagtcacaaactagtgcagcttttgacaacaact
gcagagcagcagttacggcatgctgatatagacacaagttgcaaagaagtactgtcatgc
tcaggcacttccaactctgcctctgctaactcttcaagcggttcttgcccctcctctcat
agctcgctgacggagcggcacaaaattttgcaccggctcctacaggagggtagcccctcg
gatatcaccactttgtctgttgagcctgataaaaaggacggtgcatctacttctgtatca
gtgactggacaggtacaagggaactcgagtgtaaaactagaactggatgcttcaaagaaa
aaagaatcaaaagaccatcagctcctacgatatcttttagataaagatgagaaagattta
agatcaactccgaacctgagcctggatgatgtaaaggtgaaagtagaaaagaaagaacag
atggatccttgtaccacaaacccaaccccaatgaccaaacctgctcctgaagaaattaaa
ctggagtcccagagccagtttacagctgaccttgaccagtttgatcagttactacccacg
ctggagaaggcagcccagttgccaggcttatgtgagccagagaggatggatggtgcggtc
accaatgtaaccatcaaatcggagaccctgccagcttcacttcagtccaccactgccaga
cccacttccaggctaaataggttaccagagctggaattagaagcaattgacaatcagttt
ggacagccaggaacaggtgatcagattccatgggcaaataatacagtgactgctgtaaat
cagaataaaccagaagaccaatgtattagttcacaattagatgagctcctctgtccacca
acaacggtagaaggaagaaatgacgagaaggctcttcttgaacagctagtgtcctttctc
agcggcaaagatgaaactgaactagctgaactagatagagctctgggaattgacaaactc
gtccagggaggtggattagatgtcttatcagagagatttccaccacaacaagcaacacca
cctttaatgatggaagaaagacccaacctttattcccagccttattcttctccttcacct
actgccaatctctctagccctttccaaggcatggtcaggcaaaaaccttcactggggact
atgcctgtccaagtgacacctccccgaggcgctttttcacctggcatgggcatgcagccc
cggcagactctgaacagacctccagccgcacccaaccagctgcggcttcagcttcagcag
cgcttgcaggggcaacagcagttgatccaccaaaatcgccaagctatcttgaaccagttt
gcagcaaacgctcctgttggcatcaatatgagatcaggcatgcagcagcaaattacacct
cagccacccctgaatgcccaaatgttggcacaacgccagcgggagttgtacagccagcag
caccgacagagacagctaattcagcagcaaagagccatgctgatgaggcagcaaagcttt
ggaaacaacctccctccctcatctggactgccagttcaaatggggaacccccgtcttcct
cagggtgctccgcagcaatttccctacccaccaagctatggtacaaacccaggaacccca
cctgcttcaaccagcccattttcacaactggcggcaaatcctgagtcaaccttggccaac
cgcaacagcatggtgaacagaggcatggcaggaaacatgggaggacaatttggcactgga
atcaatcctcagatgcagcaaaatgtcttccagtatccaggatcaggaatggttccccaa
ggtgaggccaactttgctccatctctaagccctgggaactccatggtgccgatgccaatc
cctcctcctcagagctctctgctccagccaactccaccctcttctgggtaccagtcacca
gacatgaaggcctggcagccaggagcaatgggaaacaatgtgttcagtcaagctgtccag
aaccagcccacacctgcgcagccaggagtgtacaacaatatgagcatcaccgtgtccatg
gcaggtggaaacacaaatgttcagaacatgaacccaatgatgggccagatgcagatgagc
tctttgcagatgccaggaatgaacactgtgtgccctgagcagataaatgatccagcactg
agacacacaggcctctactgcaaccagctctcatccactgaccttctcaaaacagaaaca
gatggaacccagcaggtgcagcaggttcaggtgtttgctgacgtccagtgtacagtgaat
ctggtaggcggggacccttacctgaaccagcctggtccactgggaactcaaaaacccaca
gcaggaccacagaccccccaggcccagcagaagagcctccttcagcagctactgactgaa
taa

DBGET integrated database retrieval system