KEGG   Canis familiaris (dog): 476176Help
Entry
476176            CDS       T01007                                 

Gene name
TMX3, TXNDC10
Definition
thioredoxin-related transmembrane protein 3
Orthology
K09585  
thioredoxin domain-containing protein 10 [EC:5.3.4.1]
Organism
cfa  Canis familiaris (dog)
Brite
Enzymes [BR:cfa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     476176 (TMX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 433 aa AA seqDB search
MAFSKGFVQDLDESFKDNRKDDIWLVDFYAPWCGHCKKLEPIWNEVGLEMKSIGSPVKVG
KMDATSYSSIASEFGVRGYPTIKLLKGDLAYNYRGPRTKDDIIEFAHRVSGALIRPLPSQ
QMFEHVQKRHRVFFVYIGGESPLKEKYIDAASELIVYTYFFSASEEVVPEYVTLKEMPAV
LVFKDETYFIYDEYEDGDLSSWINRERFQNYLTVDGFLLYELGDTGKLVAIAVIDEKNTS
IEHTRLKSIIQEVARDYRDQFHRDFQFGHMDGNDYINTLLMDELKVPTVVVLNTSNQQYF
LLDRQIKNAEDMVQFINNILDGTVEAQGGDSILQRLKRIVFDAKSTIVSIFKSSPLMGCF
LFGLPLGVVSIMCYGIYTADTDGGYIEERYEVSKSEIESQEPTEESKEQEPRSGDALVPT
VQGPKDVLEKKKD
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggctttcagtaaaggatttgtacaagatttggatgaatcgtttaaagataatcggaaa
gatgacatttggcttgtagatttttatgcaccatggtgtggccattgtaaaaaactggaa
ccgatttggaatgaagttggtcttgagatgaaaagcattggttctccagttaaagttgga
aagatggatgctacttcctattctagcattgcttcagagtttggagttcgaggttatcca
acaattaagctattaaagggggacttggcatataattatagaggaccacgaactaaagat
gatattattgagtttgctcacagagtgtctggggctctaattcggccgcttccaagtcag
caaatgtttgaacatgtgcaaaagagacatcgtgtattttttgtttacattggtggagag
tcaccgttgaaggagaaatacatagatgctgcttcagaattaattgtatatacatacttc
ttttctgcctcagaagaagtggttcctgagtatgtgacactgaaggagatgccagctgtg
cttgttttcaaagatgaaacttactttatttatgatgaatacgaggatggtgatctgtca
tcttggatcaacagggagaggtttcagaactacctgactgtggatggcttcctcttatat
gaactgggagataccggaaagcttgtggctattgcagttattgatgagaaaaatacatca
attgaacacaccagattaaagtcaattattcaggaagttgctagagattacagagaccag
ttccacagagattttcagtttggccatatggatggaaatgactatataaataccctgctg
atggatgaactcaaagtcccaacggtggttgtactaaatacttccaaccaacagtacttt
ttactagacagacagatcaagaatgccgaggacatggtgcagttcattaataacatcttg
gatggcacagtggaggcccaaggaggtgatagcatattgcagagattgaagaggatagta
tttgatgccaaatctactattgtgtctatattcaagagctctccactgatgggctgcttt
ctctttggccttccactgggggtcgtcagtatcatgtgctatggcatctacacagcagac
acagatggaggttacatagaagaacgatatgaagtatccaaaagtgaaattgaaagccaa
gaaccaacagaagaaagcaaagaacaggagccaaggagtggagatgccctagtgcctacg
gtgcaaggacccaaagatgtattagaaaagaagaaagattga

DBGET integrated database retrieval system