KEGG   Canis familiaris (dog): 476242Help
Entry
476242            CDS       T01007                                 

Gene name
PCMT1
Definition
protein-L-isoaspartate (D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
cfa  Canis familiaris (dog)
Brite
Enzymes [BR:cfa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     476242 (PCMT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 286 aa AA seqDB search
MPGARSGGTGGDSSHSGDSSGDASGAVTVWEVVSLLGKLLGTVAALKVVLYLLRVCLAMA
WKSGGASHSELIHNLRKNGIIKTDKVFEVMLATDRSHYAKCNPYMDSPQSIGFQATISAP
HMHAYALELLFDQLHEGAKALDVGSGSGILTACFARMVGSSGKVIGIDHIKELVDDSINN
VRKDDPVLLSSGRVQLVVGDGRMGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLILP
VGPAGGNQMLEQYDKLQDGSVKMKPLMGVIYVPLTDKEKQWSRDEL
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgccgggagcgcgcagtggcggcaccggcggcgacagcagtcacagcggagactccagc
ggggacgcgagcggggcggtgaccgtgtgggaggtggtctcactcttggggaagctgcta
ggcaccgtcgccgcgctgaaggtggttctgtacctgctccgggtgtgcttagcgatggcc
tggaaatccggcggcgccagccactcggagctaatccacaatctccgcaaaaatggaatc
atcaaaacagataaagtatttgaagtaatgctggctacagaccgttcccactatgcaaaa
tgtaacccttatatggattctccacaatcaataggtttccaagcaacaatcagtgctcca
cacatgcatgcatatgcactagaacttctatttgatcaattgcatgaaggagctaaagct
cttgatgtaggatctggaagtggaatccttactgcatgttttgcacgtatggttggctct
agtggaaaagtcataggaattgaccacattaaagagctagtagatgactcaataaataat
gtcagaaaggacgatccggtgcttttgtcttcagggagagtgcagctggttgtgggggat
ggaagaatgggatatgctgaagaagccccatatgatgctattcatgtgggagctgcagcc
ccagttgtaccccaggcgctgatagaccagttaaagcctggtgggagattgatattgcca
gttggtcccgcaggtggaaaccagatgttggagcagtatgacaaactacaggatggcagt
gtcaagatgaagcccctgatgggagtcatatacgtgcctttaacagataaggagaagcag
tggtccagggatgaactgtaa

DBGET integrated database retrieval system