KEGG   Canis familiaris (dog): 476506Help
Entry
476506            CDS       T01007                                 

Gene name
ALDH1L1
Definition
(RefSeq) cytosolic 10-formyltetrahydrofolate dehydrogenase
  KO
K00289  formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00670  One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    476506 (ALDH1L1)
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.6  formyltetrahydrofolate dehydrogenase
     476506 (ALDH1L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF1487 DUF4863
Motif
Other DBs
NCBI-GeneID: 476506
NCBI-ProteinID: XP_013977023
Ensembl: ENSCAFG00000029966
Position
20
AA seq 554 aa AA seqDB search
MLSLFHFLSSRLVEEVKELCDGLELENEDVYMATTFGDFIQLLVRKLRGGDEASECIIDY
VEKAVNKLTLQMPHQLFIGGMFVDAEGAKTYETINPTDGNVICQVSLAQVSDVDKAVAAA
KDAFENGLWGKISARDRGRLLYRLADLMEQHQEELATIEALDAGAVYTLALKTHVGMSIQ
TFRYFAGWCDKIQGSTIPINHARPNRNLTLTKKEPIGVCGIVIPWNYPLMMLSWKTAACL
AAGNTVVIKPAQVTPLTALKFAELTLKAGIPKGVVNILPGSGSLVGQRLSDHPDVRKIGF
TGSTEVGKHIMKSCALSNVKKVSLELGGKSPLIIFADCDLSKAVQMGMSSVFFNKGENCI
AAGRLFVEDSIHDQFVQKVVEEVKKMKIGNPLDRDTNHGPQNHQAHLQKLVEYCQHGVEE
GATLVCGGHQVPRPGFFFEPTVFTDVEDHMFIAKEESFGPIMIISRFADGDVDTVLSRAN
ATEFGLASGVFTRDLNRALYVSDRLEAGTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEVA
LNEYLRVKTVTFEY
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgctctcacttttccactttctttcctccagactggttgaggaagtaaaagagctgtgt
gatggactggaattagaaaatgaagatgtttacatggcaaccacctttggagacttcatc
caactactagtgagaaagctacgagggggcgacgaagccagcgagtgcatcattgactat
gtggaaaaggcagtgaacaaactgaccctccaaatgccccaccagctcttcatcgggggc
atgtttgtggacgccgagggtgccaagacctatgagaccatcaacccaacagatggaaat
gtcatctgccaggtgtccttggcccaggtcagcgatgttgacaaggcagtggctgcagct
aaggatgcctttgagaacggattgtgggggaagatcagtgcacgggaccggggccggctc
ctgtacaggttggcggacctcatggaacagcatcaggaggagctggccaccatcgaagct
ctagatgcaggcgctgtctacaccctggccctgaagacccatgtgggcatgtccatccag
accttccgctactttgctggctggtgcgacaaaattcagggctccaccatccccatcaac
cacgccagaccaaaccgcaacctgaccttgaccaagaaggagcctattggggtctgtggc
attgtcatcccctggaactacccattgatgatgctctcctggaagacagctgcctgcctg
gctgctgggaacacagtggtgatcaagcctgcccaggtgaccccactcacagccttgaag
tttgcagagttgaccttgaaggctggcattcccaagggggtggtcaacatcctcccggga
tctggctcgctggttggccagagactttcagaccatcctgatgtgcggaaaattgggttt
acgggttctacagaggtggggaaacacattatgaagagctgcgccctgagtaacgtgaag
aaggtgtccctggagctgggagggaagtcgcccctcatcatctttgctgactgtgacctc
agcaaggctgtgcagatggggatgagctctgtcttcttcaacaaaggggaaaactgcatt
gcagcaggccggctttttgtagaggactcgattcatgaccagtttgtgcagaaggtggta
gaagaggtgaagaagatgaaaattggcaaccctctagaccgggacaccaaccatgggcca
cagaaccaccaagcccacctacagaagctggtggagtactgccaacatggtgtggaggag
ggggccaccctggtctgtggtgggcatcaggtccctcggccaggtttcttcttcgagcca
actgttttcacagacgtggaggaccacatgttcatagccaaggaagagtcctttgggccc
atcatgatcatctctcggtttgctgacggcgatgtggacactgtgctgtctcgggccaac
gccacagagttcggcctggcctccggcgtcttcaccagagacctcaacagagccctgtac
gtcagcgacaggctggaggcaggcaccgtgtttgtcaacacatacaacaagacggatgtg
gccgctcccttcggaggcttcaagcagtccggctttggcaaagacctcggagaggtggcc
ctgaacgagtacctgcgggtcaagacggttacttttgagtactga

DBGET integrated database retrieval system