KEGG   Canis familiaris (dog): 476506Help
Entry
476506            CDS       T01007                                 

Gene name
ALDH1L1
Definition
cytosolic 10-formyltetrahydrofolate dehydrogenase-like
Orthology
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
cfa  Canis familiaris (dog)
Pathway
One carbon pool by folate
Class
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:cfa00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
20
AA seq 558 aa AA seqDB search
MRPAALTASYHRDGELVEEVKELCDGLELENEDVYMATTFGDFIQLLVRKLRGGDEASEC
IIDYVEKAVNKLTLQMPHQLFIGGMFVDAEGAKTYETINPTDGNVICQVSLAQVSDVDKA
VAAAKDAFENGLWGKISARDRGRLLYRLADLMEQHQEELATIEALDAGAVYTLALKTHVG
MSIQTFRYFAGWCDKIQGSTIPINHARPNRNLTLTKKEPIGVCGIVIPWNYPLMMLSWKT
AACLAAGNTVVIKPAQVTPLTALKFAELTLKAGIPKGVVNILPGSGSLVGQRLSDHPDVR
KIGFTGSTEVGKHIMKSCALSNVKKVSLELGGKSPLIIFADCDLSKAVQMGMSSVFFNKG
ENCIAAGRLFVEDSIHDQFVQKVVEEVKKMKIGNPLDRDTNHGPQNHQAHLQKLVEYCQH
GVEEGATLVCGGHQVPRPGFFFEPTVFTDVEDHMFIAKEESFGPIMIISRFADGDVDTVL
SRANATEFGLASGVFTRDLNRALYVSDRLEAGTVFVNTYNKTDVAAPFGGFKQSGFGKDL
GEVALNEYLRVKTVTFEY
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgaggccagctgccctcactgcctcctaccacagggatggggaactggttgaggaagta
aaagagctgtgtgatggactggaattagaaaatgaagatgtttacatggcaaccaccttt
ggagacttcatccaactactagtgagaaagctacgagggggcgacgaagccagcgagtgc
atcattgactatgtggaaaaggcagtgaacaaactgaccctccaaatgccccaccagctc
ttcatcgggggcatgtttgtggacgccgagggtgccaagacctatgagaccatcaaccca
acagatggaaatgtcatctgccaggtgtccttggcccaggtcagcgatgttgacaaggca
gtggctgcagctaaggatgcctttgagaacggattgtgggggaagatcagtgcacgggac
cggggccggctcctgtacaggttggcggacctcatggaacagcatcaggaggagctggcc
accatcgaagctctagatgcaggcgctgtctacaccctggccctgaagacccatgtgggc
atgtccatccagaccttccgctactttgctggctggtgcgacaaaattcagggctccacc
atccccatcaaccacgccagaccaaaccgcaacctgaccttgaccaagaaggagcctatt
ggggtctgtggcattgtcatcccctggaactacccattgatgatgctctcctggaagaca
gctgcctgcctggctgctgggaacacagtggtgatcaagcctgcccaggtgaccccactc
acagccttgaagtttgcagagttgaccttgaaggctggcattcccaagggggtggtcaac
atcctcccgggatctggctcgctggttggccagagactttcagaccatcctgatgtgcgg
aaaattgggtttacgggttctacagaggtggggaaacacattatgaagagctgcgccctg
agtaacgtgaagaaggtgtccctggagctgggagggaagtcgcccctcatcatctttgct
gactgtgacctcagcaaggctgtgcagatggggatgagctctgtcttcttcaacaaaggg
gaaaactgcattgcagcaggccggctttttgtagaggactcgattcatgaccagtttgtg
cagaaggtggtagaagaggtgaagaagatgaaaattggcaaccctctagaccgggacacc
aaccatgggccacagaaccaccaagcccacctacagaagctggtggagtactgccaacat
ggtgtggaggagggggccaccctggtctgtggtgggcatcaggtccctcggccaggtttc
ttcttcgagccaactgttttcacagacgtggaggaccacatgttcatagccaaggaagag
tcctttgggcccatcatgatcatctctcggtttgctgacggcgatgtggacactgtgctg
tctcgggccaacgccacagagttcggcctggcctccggcgtcttcaccagagacctcaac
agagccctgtacgtcagcgacaggctggaggcaggcaccgtgtttgtcaacacatacaac
aagacggatgtggccgctcccttcggaggcttcaagcagtccggctttggcaaagacctc
ggagaggtggccctgaacgagtacctgcgggtcaagacggttacttttgagtactga

DBGET integrated database retrieval system