KEGG   Canis familiaris (dog): 476585Help
Entry
476585            CDS       T01007                                 

Gene name
CACNA2D3
Definition
(RefSeq) calcium voltage-gated channel auxiliary subunit alpha2delta 3
  KO
K04860  voltage-dependent calcium channel alpha-2/delta-3
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04010  MAPK signaling pathway
cfa04260  Cardiac muscle contraction
cfa04261  Adrenergic signaling in cardiomyocytes
cfa04921  Oxytocin signaling pathway
cfa05410  Hypertrophic cardiomyopathy (HCM)
cfa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
cfa05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    476585 (CACNA2D3)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    476585 (CACNA2D3)
  Circulatory system
   04260 Cardiac muscle contraction
    476585 (CACNA2D3)
   04261 Adrenergic signaling in cardiomyocytes
    476585 (CACNA2D3)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    476585 (CACNA2D3)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    476585 (CACNA2D3)
   05414 Dilated cardiomyopathy (DCM)
    476585 (CACNA2D3)
Ion channels [BR:cfa04040]
 Voltage-gated cation channels
  Ca2+ channel, CACN alpha-2 delta
   476585 (CACNA2D3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VGCC_alpha2 VWA_N VWA_3 dCache_1 VWA VWA_2 dCache_2 Cache_3-Cache_2 VWA_CoxE
Motif
Other DBs
NCBI-GeneID: 476585
NCBI-ProteinID: XP_013977599
Ensembl: ENSCAFG00000008211
UniProt: J9P4V6
Position
20
AA seq 997 aa AA seqDB search
MEEMFHKKSEAVRRLVEAAEEAHLKHEFDADLQYEYFNAVLINERDKDGNFLELGKEFIL
APNDHFNNLPVNISLSDVQVPTNMYNKDPAIVNGVYWSESLNKVFVDNFDRDPSLIWQYF
GSAKGFFRQYPGIKWEPDENGVIAFDCRNRKWYIQAATSPKDVVILVDVSGSMKGLRLTI
AKQTVSSILDTLGDDDFFNIIAYNEELHYVEPCLNGTLVQADRTNKEHFREHLDKLFAKG
IGMLDIALNEAFNILSDFNHTGQGSICSQAIMLITDGAVDTYDTIFAKYNWPDRKVRIFT
YLIGREAAFADNLKWMACANKGFFTQISTLADVQENVMEYLHVLSRPKVIDQEHDVVWTE
AYIDSTLPQAQKLADDQSLVLMTTVAMPVFSKQNETRSKGILLGVVGTDVPVKELLKTIP
KYKLGIHGYAFAITNNGYILTHPELRPLYEEGKKRRKPNYSSVDLSEVEWEDRDDVLRNA
MVNRKTGKFSMEVKKTVDKGKRVLVMTNDYYYTDIKGTPFSLGVALSRGHGKYFFRGNVT
IEEGLHDLEHPDVSLADEWSYCNTDLHPEHRHLSQLEAIKLYLKGKEPLLQCDKELIQEV
LFDAVVSAPIEAYWTSLALNKSENSDKGVEVAFLGTRTGLSRINLFVGAEQLTNQDFLKA
GDKENIFNADHFPLWYRRAAEQLPGSFVYSIPFSTGIVNKSNVVTASTSIQLLDERKSPV
VAAVGIQMKLEFFQRKFWTASRQCASLDGKCSISCDDETVNCYLIDNNGFILVSEDYTQT
GDFFGEVEGAVMNKLLTMGSFKRITLYDYQAMCRANKDSSDGASGLLDPYNAFLAAVKWI
MTELVLFLVEFNLCSWWHSDMTAKAQKLKQTLEPCDTEYPAFVSERTIKETSGNIACEDC
SKSFVIQQIPSSNLFMVVVDSSCLCESMTPITMAPIEIRYNESLKCERLKAQKIRRRPES
CHGFHPEENARECGGARTLQAKMVLTLFPLLLMLFSR
NT seq 2994 nt NT seq  +upstreamnt  +downstreamnt
atggaagagatgtttcacaaaaagtctgaagcagtgcggcgtcttgtggaggctgcagaa
gaggcacatctgaaacatgaatttgatgcagacttgcagtatgaatacttcaatgctgtg
ctgataaatgaaagggacaaagatggtaattttttggagctggggaaagaattcatctta
gccccaaatgaccattttaataatttgcctgtgaacatcagtctgagtgatgtccaagtg
cccacgaacatgtacaacaaagacccagcaatcgtcaatggggtttattggtccgaatcc
ctaaataaagttttcgtcgataactttgatcgtgacccgtccctcatatggcaatacttt
ggaagtgcaaagggcttttttaggcagtatccagggattaaatgggaaccagatgagaat
ggagtcattgcctttgactgcaggaaccgaaaatggtacatccaggcagcgacttctccg
aaagacgtggtcattttagttgatgtcagtggcagcatgaaaggactccgtctcactatc
gccaagcaaaccgtctcatctattttggatacactgggggatgatgactttttcaacatt
attgcttataatgaggagcttcactacgtggaaccttgcctgaatgggacattggtgcaa
gctgacaggacaaacaaggagcacttcagggagcatctggacaaactttttgccaaagga
attggaatgctggatatagctctgaacgaggccttcaacattctcagtgatttcaaccac
acaggacaaggaagcatctgcagccaggccatcatgctcatcaccgatggggcagtggac
acttatgatactatctttgcgaagtacaattggccagaccgaaaggtccgcatcttcacc
tacctcattggacgagaggctgcttttgcagacaatctcaagtggatggcttgtgccaac
aaaggatttttcacccagatctccaccttggctgatgtacaggaaaatgtcatggaatac
ctacacgtactgagccggcccaaagtcatcgatcaagagcacgacgtggtatggactgaa
gcttacatcgacagcactctccctcaggcacaaaagctggccgatgatcagagcctcgtc
ctgatgaccacggtcgccatgcctgtgtttagtaagcagaacgaaaccagatcgaaaggc
attcttctgggtgtggttggcacagatgtcccagtgaaagagcttctgaagaccattccc
aaatacaagttagggattcacggttatgcctttgcaatcacaaataatggatatatcctg
acgcatccagaactgagaccactgtatgaagaaggaaaaaagcgaaggaaacccaactac
agtagtgttgacctctctgaggtggagtgggaagaccgggatgatgtgttaagaaacgcc
atggtaaaccgaaagactgggaagttctccatggaggtgaagaagacagtggacaaaggg
aaacgggttttggtgatgacaaatgactactattatacagacatcaagggtactcctttc
agcttaggtgtggcgctctccagaggtcatgggaaatatttcttccgagggaatgtaacc
attgaagaaggcctacatgacttagagcaccctgacgtgtccttggcagatgaatggtcc
tactgcaacaccgacctacaccccgagcaccgtcacctgtctcagctagaagctatcaag
ctctacctcaaaggcaaagaacctctgctccaatgtgacaaagaattgatacaagaagtc
ctctttgatgccgtggtgagcgctcccattgaagcctattggaccagtcttgccctcaac
aaatctgagaattctgacaagggcgtggaggttgccttcctcggcactcgtactggcctc
tcgaggatcaatctgtttgtgggggctgagcagctcaccaatcaggatttcttgaaagct
ggagacaaggagaacatttttaatgcagaccatttccctctctggtaccgaagagctgct
gagcagcttcctgggagttttgtctactccatcccattcagcacaggaatagtcaacaaa
agcaacgtggtgacagcgagtacctccatccagctcctggatgaacggaaatctcccgtg
gtggcagctgtaggcattcagatgaaacttgaatttttccagaggaagttctggactgcc
agcagacagtgtgcctctctggatggcaaatgctccatcagctgtgatgatgagactgtg
aactgttacctcatagacaataatgggtttattctggtgtctgaagactacacacagact
ggagacttttttggtgaggtcgagggagctgtgatgaacaaactgttaacaatgggctcc
tttaaaagaattaccctttatgactatcaagccatgtgcagagccaacaaggacagcagt
gatggtgccagtgggctgctggatccttataatgccttccttgctgcagtaaaatggata
atgacagaacttgtcctgttcctggtggaatttaacctctgcagttggtggcactcagat
atgacagctaaagcccagaaattgaaacagaccctggagccttgtgatactgaatatcca
gcgtttgtctctgagcgtaccatcaaggaaacctcagggaacattgcttgtgaagactgc
tccaagtcctttgtcatccaacaaattccaagcagcaatctgttcatggtggtggtggac
agcagctgcctgtgtgagtccatgacccccatcaccatggcgcccattgaaatcaggtat
aacgaatcccttaagtgtgaacgtttaaaggcccagaagatcagaaggcgtccggagtct
tgtcatggcttccatcctgaggagaatgcaagagagtgtggaggtgcacggactctgcag
gccaagatggtccttaccctcttccctctgctcttaatgctcttctcaaggtga

DBGET integrated database retrieval system