KEGG   Canis familiaris (dog): 476626Help
Entry
476626            CDS       T01007                                 

Gene name
LAMB2, LAMC1
Definition
laminin, beta 2 (laminin S)
Orthology
K06243  
laminin, beta 2
Organism
cfa  Canis familiaris (dog)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:cfa04151]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:cfa04512]
Cellular Processes; Cell communication; Focal adhesion [PATH:cfa04510]
Human Diseases; Cancers; Pathways in cancer [PATH:cfa05200]
Human Diseases; Cancers; Small cell lung cancer [PATH:cfa05222]
Human Diseases; Infectious diseases; Amoebiasis [PATH:cfa05146]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:cfa05145]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
20
AA seq 1878 aa AA seqDB search
MSSWPEAAASAHGHASVCKPTAETQPTRKAWCMAFASAATKQLVPTVSAARTCTRPPMAS
SRVWVPPRLPGMERAPGERGRDLRGQPGPWELHVGLLLSVLATALAQALAPDMPGCSRGS
CYPATGDLLVGRADRLTASSTCGLHGPQPYCIVSHLQDEKKCFLCDSRRPFSARDNPNSH
RIQNVVTSFAPQRRAAWWQSENGVPVVTIQLDLEAEFHFTHLIMTFKTFRPAAMLVERSA
DFGRTWHVYRYFSYDCGADFPGVPLAPPRHWDDIVCESRYSEIEPSTEGEVIYRVLDPAI
PIPDPYSPRIQNLLKITNLRVNLTRLHTLGDNLLDPRREIREKYYYALYELVVRGNCFCY
GHASQCAPAPGAPAHAEGMVHGACVCKHNTRGLNCEQCQDFYHDLPWRPAEDGHSHACRK
CECHGHAHSCHFDMAIYLASGNVSGGVCDGCQHNTAGRHCELCRPFFYRDPSKDLRDPAM
CRSCDCDPMGSQDGGRCDPHDDPALGLVSGQCRCKEHVVGSRCQQCRDGFFGLSASDPAG
CRRCQCDARGTVPGTTSCDPNSGTCFCKRLVTGRGCNHCLPGHWGLSHDLLGCRPCDCDV
GGALDPQCSEATGQCRCRQHMVGRRCEQVQPGYFRPFLDHLTWEAEDTRGQVLDVVERLV
TSSGTPSWTGRGFVRLQEGQALEFLVGSVPRAMDYDLLLRLEPQVPKQWAEMEVTVQRPG
PVSAHSLCGHVLPKDDHIPGTLQPETRYMVFPRPVCLEPGISYKLLLKLVRTGGSAQTEA
PYSGPSLLIDSLVLLPRVLVLEMFSGGDAAALERRATFERYRCHEEGLVPSKTLPSEACA
PLLISLSTLLYSGALPCQCDPQGSLSSECNPHGGQCVCKPAVVGRRCDHCAPGFYGFGPT
GCQASALPSACQCSPEGALSGLCEETSGQCPCRTGAFGLRCDRCQRGQWGFPSCQPCVCN
GHADECDTHTGACVGCRDHTGGEHCERCIAGFHGDPRLPYGGQCRPCPCPEGPGSQRHFA
TSCHRDGYSQQIMCHCRAGYTGLRCEACAPGHFGDPSRPDGQCQPCECNGNIDPMDPDAC
DPRTGQCLRCLYHTEGPHCAHCKPGFYGQAARQSCHRCTCNLLGTDPQQCPSIDRCNCDP
SSGQCPCLPNVQGPTCDRCAPNFWNLTSGHGCQPCTCHPSRARGPTCNEFTGQCHCRAGF
GGRTCSECQELHWGDPGLQCRACDCDPHGIDTPQCHRSTGHCSCRPGVSGVRCDQCARGF
SGVFPACHPCHTCFGDWDRVVQDLAARTRRLEQRVQDLQQTGVLGAFESSFWRIQEKLGT
VQGIVGARNTSAASTAQLVEATEELRREIGEATEHLTQLEAELTDVQDENFNANHALSSL
ERDGLALNLTLRQLDQHLDLLKHSNFLGAYDSIRHAHSLSAEAEHRANTSALTVPSPVSN
SADTRHRTEVLMSAQREDFNRKHKANQQALGKLSARTHSLSLTAINELVCGPPGDAPCAT
SPCGGAGCLDEDGQPRCGGLGCNGAVAMADLALGRARHTQAELQRALAEGGGILSQVAET
RRQAGEAQQRAQAALDKANASRGQVEKANQELRELIQSVKDFLSQEGADPDSIEMVATRV
LELSIPASPEQIQHLAGAIAERVRSLADVDTILARTVGDVRRAEQLLQDARRARSRAEGE
KQKAETVQAALEEAQRAQGAAQGAIQGAVVDTQDTERTLHQVQAKMAGAEQALSSAGERA
QELDGFLEALKLKRAGNSLAASSAEETAGSAQGRAREAEQLLQGPLGDQYQTVKALAERK
AQGVLAAQVRAEQLRDEARGLLQAAQDKLQRLQELEGTYEENERALEGKAAQLDGLEARM
RSVLQAINLQVQIYNTCQ
NT seq 5637 nt NT seq  +upstreamnt  +downstreamnt
atgagctcatggccagaggcagctgccagtgcccatggccatgcctctgtgtgtaagccc
acagctgagacccagccaacacgaaaggcatggtgcatggcctttgcgtctgctgccacc
aaacagctggtacccactgtgagtgctgccaggacctgtaccagaccacccatggcaagc
agcagagtctgggtacctccacgcctgccagggatggagcgggccccaggggaacgaggg
agggacctgcggggacagcctgggccctgggagcttcatgtgggcctactgttgagtgtg
ctggccactgccctggcccaggccctggccccggatatgccaggctgttcgaggggaagc
tgctaccctgccacaggtgacttgctagtgggccgtgctgacagactgactgcctcatcc
acctgtggcttacatggcccccaaccttactgcatcgttagtcacctacaggatgagaag
aagtgcttcctgtgtgactcccggcgccctttctctgccagagacaacccaaacagccat
cgcatccagaatgtagttaccagctttgcaccacagcgccgggcagcctggtggcagtca
gagaatggtgtccccgtggtcaccatccagctggacttggaggctgagtttcatttcacg
cacctcattatgaccttcaagacgtttcgtcctgctgccatgctagtggaacgctcagct
gactttggacgcacctggcatgtgtaccgatatttttcctatgactgtggggctgacttt
ccaggagtcccactggccccaccacgacactgggatgacatagtctgtgagtcccgctac
tcagagattgagccatccactgaaggcgaggtcatctatcgggtgctggatcctgccatc
cctatcccagacccctatagcccacggatccagaacctgctgaagatcaccaacctacgg
gtgaacctgacacggctacatacgctgggagacaacctgcttgacccacggcgggagatc
cgtgagaaatactattatgccctttacgagctggttgttcgaggcaactgcttctgttat
ggacacgcctcacagtgtgcacctgccccaggagcaccagcccatgctgagggcatggtt
catggggcctgcgtctgcaaacacaacactcgaggcctcaactgtgaacagtgtcaggat
ttctatcatgacttgccctggcgtccagctgaggatggccacagtcatgcctgcaggaag
tgtgagtgccatgggcatgcacacagctgccactttgatatggccatatacctggcatct
ggcaacgtgagtggaggcgtgtgtgatggatgtcagcacaatacagctgggcgccactgt
gagctctgccgacccttcttctaccgtgatccaagcaaggacctgcgggacccagctatg
tgtcgctcctgtgattgtgaccccatgggttcccaagatggtggtcgctgcgatccccat
gatgatcctgctctggggctggtttcgggccagtgtcgctgcaaagaacatgtggtgggc
tctcgctgccagcaatgtcgtgatggcttctttggacttagtgccagtgaccctgcaggc
tgccggcggtgccagtgtgatgcacgaggcacagtgcctgggaccacctcttgtgacccc
aacagtggaacctgtttctgcaagcgtctagtgactggacgtggctgcaaccactgcctg
cctggccactggggcctgagccatgacctgcttggctgtcgtccttgtgattgcgacgtg
ggcggtgccttggatccccagtgcagtgaggccacaggtcagtgccgctgtcgccagcac
atggtggggcgacgctgtgagcaggtgcagcctggctacttccggcctttccttgatcac
ctaacttgggaggctgaggatacccgaggacaggtgcttgatgtggtggagcgcttggtg
acttccagtgggactccatcctggaccggccggggctttgttaggctgcaggagggtcag
gcactggagtttctggtgggctctgtgccgagagccatggactatgacctgctgttgcgc
ttggaacctcaggtccccaagcaatgggcagagatggaagtgaccgtgcagcgcccaggg
cctgtgtctgcccacagcctatgtgggcatgtgctgcccaaggatgaccacatcccaggg
actctgcaaccagaaaccaggtatatggtgtttcccagacctgtctgtcttgagcctggc
atctcctacaagctgcttctgaagttggtgcgaacagggggaagtgcccagaccgaggct
ccctactctggacccagtctgctcattgactcgctggtgctgcttccccgtgtcctggtg
ctagagatgtttagtgggggtgatgctgctgccctggagcgccgtgccacctttgaacgc
taccgttgccatgaggagggtctggtgcctagcaagacccttccctctgaggcctgcgcc
cccctccttatcagtctgtccaccctcctctacagtggtgccttgccctgtcagtgtgac
ccccagggctcactgagttctgagtgcaatcctcatggcggtcagtgcgtgtgtaaacct
gcagtggtggggcgccgctgtgatcactgtgcccctggcttctacggctttggtcccaca
ggctgtcaagcctctgccttgccctcagcctgccagtgtagccctgagggggcactcagt
ggcctatgtgaagagaccagtgggcaatgcccctgccgaactggtgcctttgggcttcgc
tgcgatcgctgccagcgtggccagtggggattccctagctgccagccatgtgtctgcaat
gggcatgccgacgaatgtgatacccacacaggcgcttgcgtgggctgccgtgatcacaca
gggggtgagcactgtgaaaggtgcattgctggcttccatggggacccaaggctaccatat
gggggtcagtgccggccctgtccctgccctgaaggccctgggagccagcggcactttgct
acttcttgccatcgggatgggtactcccagcagatcatgtgccactgtagggcagggtac
acagggctacggtgtgaagcttgtgcccctggacactttggggacccatcgaggccagat
ggccagtgccaaccgtgtgagtgcaatgggaacattgaccctatggaccctgatgcctgt
gatccccgcacggggcagtgcctgcgctgcttataccacacggaggggccacactgtgcc
cactgcaagcctggcttctatgggcaggctgcccgacagagctgtcaccgctgtacctgc
aacttgctgggaacagatccccagcagtgcccgtccattgatcgctgcaactgtgaccca
agcagtgggcagtgcccatgcctccccaatgtccagggccctacctgtgaccgctgtgcc
cccaacttctggaaccttactagtggccatggctgccagccctgtacctgtcatccaagc
cgagccagaggccccacctgcaatgagttcacagggcagtgccactgccgtgctggcttt
ggtgggcgaacctgttctgaatgccaggagctccactggggagaccctgggttgcagtgt
cgtgcctgtgattgtgaccctcatggaatagacacacctcagtgtcaccgttctacaggt
cactgcagctgccgcccaggagtgtctggcgtgcgctgtgaccagtgtgctcgtggcttt
tccggggtctttcctgcctgccacccatgtcacacatgcttcggggactgggaccgtgtg
gtacaggatttggctgcccgtacacggcgcctggagcagcgggtgcaggatttacaacag
actggtgtgctgggtgcttttgagagcagcttctggcgcatccaggagaagctggggact
gtgcaggggatcgtgggtgcccgcaacacctcagctgcctccactgcacagctcgtggag
gccacagaggagctgcggcgtgaaattggagaggccactgagcacctgacccagctggaa
gcagaactgacagatgtgcaggatgagaacttcaatgccaaccatgcacttagcagtctg
gagcgagatgggcttgcgcttaatctcacgctgaggcagctggaccagcatctggacctg
ctcaagcattcaaatttcctgggtgcctatgacagcatccgccacgcccacagtctctct
gcagaggcagaacatcgtgccaacacatcagctttgacagtgcctagccctgtgagcaac
tcagcagatactcggcaccgtacagaggtgctaatgagtgcccagagggaggacttcaac
cgcaaacataaggccaaccagcaggcactaggcaaactctctgcccgtacccactccctg
agcctgacagccataaatgaactggtgtgtggacccccaggggatgcaccctgtgctaca
agcccttgcgggggtgctggctgtctggatgaggatgggcagccccgctgtgggggcctc
ggctgcaatggggcagtagccatggcggacctggcactgggtcgggcccggcacacacag
gcagagttgcagcgggcactggcagaaggtggaggcatcctcagccaggtggctgagacc
cgtcggcaagcaggcgaggcacagcaacgggcccaggcagccctggacaaagctaatgct
tccagaggacaggtggagaaggccaaccaagaacttcgggaacttatccagagtgtgaag
gacttcctcagccaggagggggctgatcccgatagcattgagatggtggccacaagagtg
ctagagctctccatcccagcatcacctgagcagatacagcacctggcaggtgcaattgca
gagagagtccggagcctggcagatgtggacacaatcctggcgcgtacagtgggagatgtg
cgtcgggcagagcagctactacaagatgcacggcgggcaaggagccgggctgagggtgag
aagcagaaggcagaaacagtacaggcagcactggaggaagcccagagggcacagggtgct
gctcagggcgccatccagggggcagtagttgacacacaggacacagagcggaccctgcac
caggtgcaggcgaagatggcaggtgcagagcaggcactgagttctgcaggtgagcgggct
caagaattggatggtttcctggaggctctgaaattgaaacgagcagggaatagcctggca
gcctctagtgctgaagaaacagcaggcagtgcccagggtcgtgcccgggaggctgagcag
ctgctgcagggcccactaggcgaccagtaccagacagtgaaggccttggctgagcgcaag
gcccagggtgtgctggctgcacaggtgcgggcagaacaacttcgggatgaagctcgtggc
ttgttgcaggctgcgcaggacaagctgcaacgactgcaagagctggaaggcacctatgag
gagaacgagcgggcactggaaggcaaagcagcccaattggatgggctggaggccaggatg
cgtagtgtgcttcaagccatcaacttgcaggtccagatctacaacacctgccagtga

DBGET integrated database retrieval system