KEGG   Canis familiaris (dog): 476626Help
Entry
476626            CDS       T01007                                 

Gene name
LAMB2, LAMC1
Definition
(RefSeq) laminin, beta 2 (laminin S)
  KO
K06243  
laminin, beta 2
Organism
cfa  Canis familiaris (dog)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    476626 (LAMB2)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    476626 (LAMB2)
 Cellular Processes
  Cellular community
   04510 Focal adhesion
    476626 (LAMB2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    476626 (LAMB2)
   05222 Small cell lung cancer
    476626 (LAMB2)
  Infectious diseases
   05146 Amoebiasis
    476626 (LAMB2)
   05145 Toxoplasmosis
    476626 (LAMB2)
Cell adhesion molecules and their ligands [BR:cfa04516]
 1. Immunoglobulin Superfamily
  Others
   LU; Lutheran blood group glycoprotein [KO:K06578]
    Laminin-11 Extracellular matrix (ECM) components
     476626 (LAMB2)
    Laminin-14 Extracellular matrix (ECM) components
     476626 (LAMB2)
 2. Integrin Family
  Beta1 integrins
   VLA-3
    ITGB1; integrin beta 1 [KO:K05719]
     Laminin-11 Extracellular matrix (ECM) components
      476626 (LAMB2)
   VLA-6
      476626 (LAMB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
20
AA seq 1856 aa AA seqDB search
MYSCPRSTPCFPSCRASQLCSKSQDSASGGTAAGWRIEWEINPGLTPAGMERAPGERGRD
LRGQPGPWELHVGLLLSVLATALAQALAPDMPGCSRGSCYPATGDLLVGRADRLTASSTC
GLHGPQPYCIVSHLQDEKKCFLCDSRRPFSARDNPNSHRIQNVVTSFAPQRRAAWWQSEN
GVPVVTIQLDLEAEFHFTHLIMTFKTFRPAAMLVERSADFGRTWHVYRYFSYDCGADFPG
VPLAPPRHWDDIVCESRYSEIEPSTEGEVIYRVLDPAIPIPDPYSPRIQNLLKITNLRVN
LTRLHTLGDNLLDPRREIREKYYYALYELVVRGNCFCYGHASQCAPAPGAPAHAEGMVHG
ACVCKHNTRGLNCEQCQDFYHDLPWRPAEDGHSHACRKCECHGHAHSCHFDMAIYLASGN
VSGGVCDGCQHNTAGRHCELCRPFFYRDPSKDLRDPAMCRSCDCDPMGSQDGGRCDPHDD
PALGLVSGQCRCKEHVVGSRCQQCRDGFFGLSASDPAGCRRCQCDARGTVPGTTSCDPNS
GTCFCKRLVTGRGCNHCLPGHWGLSHDLLGCRPCDCDVGGALDPQCSEATGQCRCRQHMV
GRRCEQVQPGYFRPFLDHLTWEAEDTRGQVLDVVERLVTSSGTPSWTGRGFVRLQEGQAL
EFLVGSVPRAMDYDLLLRLEPQVPKQWAEMEVTVQRPGPVSAHSLCGHVLPKDDHIPGTL
QPETRYMVFPRPVCLEPGISYKLLLKLVRTGGSAQTEAPYSGPSLLIDSLVLLPRVLVLE
MFSGGDAAALERRATFERYRCHEEGLVPSKTLPSEACAPLLISLSTLLYSGALPCQCDPQ
GSLSSECNPHGGQCVCKPAVVGRRCDHCAPGFYGFGPTGCQASALPSACQCSPEGALSGL
CEETSGQCPCRTGAFGLRCDRCQRGQWGFPSCQPCVCNGHADECDTHTGACVGCRDHTGG
EHCERCIAGFHGDPRLPYGGQCRPCPCPEGPGSQRHFATSCHRDGYSQQIMCHCRAGYTG
LRCEACAPGHFGDPSRPDGQCQPCECNGNIDPMDPDACDPRTGQCLRCLYHTEGPHCAHC
KPGFYGQAARQSCHRCTCNLLGTDPQQCPSIDRCNCDPSSGQCPCLPNVQGPTCDRCAPN
FWNLTSGHGCQPCTCHPSRARGPTCNEFTGQCHCRAGFGGRTCSECQELHWGDPGLQCRA
CDCDPHGIDTPQCHRSTGHCSCRPGVSGVRCDQCARGFSGVFPACHPCHTCFGDWDRVVQ
DLAARTRRLEQRVQDLQQTGVLGAFESSFWRIQEKLGTVQGIVGARNTSAASTAQLVEAT
EELRREIGEATEHLTQLEAELTDVQDENFNANHALSSLERDGLALNLTLRQLDQHLDLLK
HSNFLGAYDSIRHAHSLSAEAEHRANTSALTVPSPVSNSADTRHRTEVLMSAQREDFNRK
HKANQQALGKLSARTHSLSLTAINELVCGPPGDAPCATSPCGGAGCLDEDGQPRCGGLGC
NGAVAMADLALGRARHTQAELQRALAEGGGILSQVAETRRQAGEAQQRAQAALDKANASR
GQVEKANQELRELIQSVKDFLSQEGADPDSIEMVATRVLELSIPASPEQIQHLAGAIAER
VRSLADVDTILARTVGDVRRAEQLLQDARRARSRAEGEKQKAETVQAALEEAQRAQGAAQ
GAIQGAVVDTQDTERTLHQVQAKMAGAEQALSSAGERAQELDGFLEALKLKRAGNSLAAS
SAEETAGSAQGRAREAEQLLQGPLGDQYQTVKALAERKAQGVLAAQVRAEQLRDEARGLL
QAAQDKLQRLQELEGTYEENERALEGKAAQLDGLEARMRSVLQAINLQVQIYNTCQ
NT seq 5571 nt NT seq  +upstreamnt  +downstreamnt
atgtactcctgcccaagatccactccatgctttccttcttgccgtgcttctcaactttgc
tcaaagtcgcaggactcagctagtggagggaccgctgctggctggaggattgagtgggaa
atcaaccccggacttactccggctgggatggagcgggccccaggggaacgagggagggac
ctgcggggacagcctgggccctgggagcttcatgtgggcctactgttgagtgtgctggcc
actgccctggcccaggccctggccccggatatgccaggctgttcgaggggaagctgctac
cctgccacaggtgacttgctagtgggccgtgctgacagactgactgcctcatccacctgt
ggcttacatggcccccaaccttactgcatcgttagtcacctacaggatgagaagaagtgc
ttcctgtgtgactcccggcgccctttctctgccagagacaacccaaacagccatcgcatc
cagaatgtagttaccagctttgcaccacagcgccgggcagcctggtggcagtcagagaat
ggtgtccccgtggtcaccatccagctggacttggaggctgagtttcatttcacgcacctc
attatgaccttcaagacgtttcgtcctgctgccatgctagtggaacgctcagctgacttt
ggacgcacctggcatgtgtaccgatatttttcctatgactgtggggctgactttccagga
gtcccactggccccaccacgacactgggatgacatagtctgtgagtcccgctactcagag
attgagccatccactgaaggcgaggtcatctatcgggtgctggatcctgccatccctatc
ccagacccctatagcccacggatccagaacctgctgaagatcaccaacctacgggtgaac
ctgacacggctacatacgctgggagacaacctgcttgacccacggcgggagatccgtgag
aaatactattatgccctttacgagctggttgttcgaggcaactgcttctgttatggacac
gcctcacagtgtgcacctgccccaggagcaccagcccatgctgagggcatggttcatggg
gcctgcgtctgcaaacacaacactcgaggcctcaactgtgaacagtgtcaggatttctat
catgacttgccctggcgtccagctgaggatggccacagtcatgcctgcaggaagtgtgag
tgccatgggcatgcacacagctgccactttgatatggccatatacctggcatctggcaac
gtgagtggaggcgtgtgtgatggatgtcagcacaatacagctgggcgccactgtgagctc
tgccgacccttcttctaccgtgatccaagcaaggacctgcgggacccagctatgtgtcgc
tcctgtgattgtgaccccatgggttcccaagatggtggtcgctgcgatccccatgatgat
cctgctctggggctggtttcgggccagtgtcgctgcaaagaacatgtggtgggctctcgc
tgccagcaatgtcgtgatggcttctttggacttagtgccagtgaccctgcaggctgccgg
cggtgccagtgtgatgcacgaggcacagtgcctgggaccacctcttgtgaccccaacagt
ggaacctgtttctgcaagcgtctagtgactggacgtggctgcaaccactgcctgcctggc
cactggggcctgagccatgacctgcttggctgtcgtccttgtgattgcgacgtgggcggt
gccttggatccccagtgcagtgaggccacaggtcagtgccgctgtcgccagcacatggtg
gggcgacgctgtgagcaggtgcagcctggctacttccggcctttccttgatcacctaact
tgggaggctgaggatacccgaggacaggtgcttgatgtggtggagcgcttggtgacttcc
agtgggactccatcctggaccggccggggctttgttaggctgcaggagggtcaggcactg
gagtttctggtgggctctgtgccgagagccatggactatgacctgctgttgcgcttggaa
cctcaggtccccaagcaatgggcagagatggaagtgaccgtgcagcgcccagggcctgtg
tctgcccacagcctatgtgggcatgtgctgcccaaggatgaccacatcccagggactctg
caaccagaaaccaggtatatggtgtttcccagacctgtctgtcttgagcctggcatctcc
tacaagctgcttctgaagttggtgcgaacagggggaagtgcccagaccgaggctccctac
tctggacccagtctgctcattgactcgctggtgctgcttccccgtgtcctggtgctagag
atgtttagtgggggtgatgctgctgccctggagcgccgtgccacctttgaacgctaccgt
tgccatgaggagggtctggtgcctagcaagacccttccctctgaggcctgcgcccccctc
cttatcagtctgtccaccctcctctacagtggtgccttgccctgtcagtgtgacccccag
ggctcactgagttctgagtgcaatcctcatggcggtcagtgcgtgtgtaaacctgcagtg
gtggggcgccgctgtgatcactgtgcccctggcttctacggctttggtcccacaggctgt
caagcctctgccttgccctcagcctgccagtgtagccctgagggggcactcagtggccta
tgtgaagagaccagtgggcaatgcccctgccgaactggtgcctttgggcttcgctgcgat
cgctgccagcgtggccagtggggattccctagctgccagccatgtgtctgcaatgggcat
gccgacgaatgtgatacccacacaggcgcttgcgtgggctgccgtgatcacacagggggt
gagcactgtgaaaggtgcattgctggcttccatggggacccaaggctaccatatgggggt
cagtgccggccctgtccctgccctgaaggccctgggagccagcggcactttgctacttct
tgccatcgggatgggtactcccagcagatcatgtgccactgtagggcagggtacacaggg
ctacggtgtgaagcttgtgcccctggacactttggggacccatcgaggccagatggccag
tgccaaccgtgtgagtgcaatgggaacattgaccctatggaccctgatgcctgtgatccc
cgcacggggcagtgcctgcgctgcttataccacacggaggggccacactgtgcccactgc
aagcctggcttctatgggcaggctgcccgacagagctgtcaccgctgtacctgcaacttg
ctgggaacagatccccagcagtgcccgtccattgatcgctgcaactgtgacccaagcagt
gggcagtgcccatgcctccccaatgtccagggccctacctgtgaccgctgtgcccccaac
ttctggaaccttactagtggccatggctgccagccctgtacctgtcatccaagccgagcc
agaggccccacctgcaatgagttcacagggcagtgccactgccgtgctggctttggtggg
cgaacctgttctgaatgccaggagctccactggggagaccctgggttgcagtgtcgtgcc
tgtgattgtgaccctcatggaatagacacacctcagtgtcaccgttctacaggtcactgc
agctgccgcccaggagtgtctggcgtgcgctgtgaccagtgtgctcgtggcttttccggg
gtctttcctgcctgccacccatgtcacacatgcttcggggactgggaccgtgtggtacag
gatttggctgcccgtacacggcgcctggagcagcgggtgcaggatttacaacagactggt
gtgctgggtgcttttgagagcagcttctggcgcatccaggagaagctggggactgtgcag
gggatcgtgggtgcccgcaacacctcagctgcctccactgcacagctcgtggaggccaca
gaggagctgcggcgtgaaattggagaggccactgagcacctgacccagctggaagcagaa
ctgacagatgtgcaggatgagaacttcaatgccaaccatgcacttagcagtctggagcga
gatgggcttgcgcttaatctcacgctgaggcagctggaccagcatctggacctgctcaag
cattcaaatttcctgggtgcctatgacagcatccgccacgcccacagtctctctgcagag
gcagaacatcgtgccaacacatcagctttgacagtgcctagccctgtgagcaactcagca
gatactcggcaccgtacagaggtgctaatgagtgcccagagggaggacttcaaccgcaaa
cataaggccaaccagcaggcactaggcaaactctctgcccgtacccactccctgagcctg
acagccataaatgaactggtgtgtggacccccaggggatgcaccctgtgctacaagccct
tgcgggggtgctggctgtctggatgaggatgggcagccccgctgtgggggcctcggctgc
aatggggcagtagccatggcggacctggcactgggtcgggcccggcacacacaggcagag
ttgcagcgggcactggcagaaggtggaggcatcctcagccaggtggctgagacccgtcgg
caagcaggcgaggcacagcaacgggcccaggcagccctggacaaagctaatgcttccaga
ggacaggtggagaaggccaaccaagaacttcgggaacttatccagagtgtgaaggacttc
ctcagccaggagggggctgatcccgatagcattgagatggtggccacaagagtgctagag
ctctccatcccagcatcacctgagcagatacagcacctggcaggtgcaattgcagagaga
gtccggagcctggcagatgtggacacaatcctggcgcgtacagtgggagatgtgcgtcgg
gcagagcagctactacaagatgcacggcgggcaaggagccgggctgagggtgagaagcag
aaggcagaaacagtacaggcagcactggaggaagcccagagggcacagggtgctgctcag
ggcgccatccagggggcagtagttgacacacaggacacagagcggaccctgcaccaggtg
caggcgaagatggcaggtgcagagcaggcactgagttctgcaggtgagcgggctcaagaa
ttggatggtttcctggaggctctgaaattgaaacgagcagggaatagcctggcagcctct
agtgctgaagaaacagcaggcagtgcccagggtcgtgcccgggaggctgagcagctgctg
cagggcccactaggcgaccagtaccagacagtgaaggccttggctgagcgcaaggcccag
ggtgtgctggctgcacaggtgcgggcagaacaacttcgggatgaagctcgtggcttgttg
caggctgcgcaggacaagctgcaacgactgcaagagctggaaggcacctatgaggagaac
gagcgggcactggaaggcaaagcagcccaattggatgggctggaggccaggatgcgtagt
gtgcttcaagccatcaacttgcaggtccagatctacaacacctgccagtga

DBGET integrated database retrieval system