KEGG   Canis familiaris (dog): 476627Help
Entry
476627            CDS       T01007                                 

Gene name
USP19
Definition
ubiquitin specific peptidase 19
Orthology
K11847  
ubiquitin carboxyl-terminal hydrolase 19 [EC:3.4.19.12]
Organism
cfa  Canis familiaris (dog)
Brite
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     476627 (USP19)
Peptidases [BR:cfa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   476627 (USP19)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
20
AA seq 1362 aa AA seqDB search
MSGGASATGPRRGPPGLEEATSKKKQKDRANQESKDGDPRRGSASSREEQAKEELLLDWR
QSADEVIVKLRVGAGPLRLEEVDAAFTDTDCVVRLPGGRQWGGVFYAEIESSCTKVQARK
GGLLQLALPKKVPLLTWPSLLKKPLGTQEVVPGLRCQENGQEPSPIALEPGPEPRRAKQE
ARNQKRAQGRGEVGAGAGPGAQAGPSAKRAVHLRRGPEGEGSRDGPGPRGDAPPFLAETA
TQAEAEEQLRVPPLNPQTCLLGSEENLALLTGEKTVSPRNDPVSPAMSRSRDPEKGDRSK
EEMAVAADAVTLVDGKEPESMVNLAFVKNDSYEKGPDSVVVHVYVKEIRRDTSRVLFREQ
DFTLIFQTRDGNFLRLHPGCGPHTLFRWQVKLRNLIEPEQCTFCFTASRIDICLRKRQSQ
RWGGLEAPAARGAVGGAKVAVPTGPTPLDSAPPGGTPHPLTGQEEARAVEKEKPKPRSED
TGLDGVAARTPMEHVAPKPEPHLASPKPTCMVPPMPHSPVSGDSVEEEEEEEKKVCLPGF
TGLVNLGNTCFMNSVIQSLSNTRELRDFFHDRSFETEINYNNPLGTGGRLAIGFAVLLRA
LWKGTHHAFQPSKLKAIVASKASQFTGYAQHDAQEFMAFLLDGLHEDLNRIQNKPYTETV
DSDGRPDEVVAEEAWQRHKMRNDSFIVDLFQGQYKSKLVCPVCAKVSITFDPFLYLPVPL
PQKQKVLPVFYFAREPHSKPIKFLVSISKENSSASEVLDSLSQSVHVKPENLRLAEVIKN
RFHRVFLPSHSLDTVSPSDTLLCFELLSPELAKERVVVLEVQQRPQVPSIPISKCAACQR
KQQSEDEKLKRCTRCYRVGYCNQLCQKTHWPDHKGLCRPENIGYPFLVSVPASRLIYARL
AQLLEGYARYSVSVFQPPFQPGRMALESQGPGCTTLLSTSSLEAGDSERDPIQPPELQLV
TPVAEGDTGVPRAWAAPDRGPVPSTSGVSSEVLASGPVEVGSLPAGERVSRPEAAVPGYQ
HPSEAMNSHTPQFFIYKIDASNREQRLEDKGDTPLELGEDCSLALVWRNNERLQEFVLVA
SKELECAEDPGSAGEAARAGHFTLDQCLNLFTRPEVLAPEEAWYCPQCKQHREASKQLLL
WRLPNVLIVQLKRFSFRSFIWRDKINDLVEFPVRNLDLSKFCIGQKEEQLPSYDLYAVIN
HYGGMIGGHYTACARLPNDRSSQRSDVGWRLFDDSTVTTVDESQVVTRYAYVLFYRRRNS
PVERPPRAGHSEHHPDLGPAAEAAASQASRIWRELEAEEEPVPEGPVPLGPWGPQDWVGP
PPRGPTTSDEGCLRYFVLGTVAALVALVLNMFYPLVSQSCWR
NT seq 4089 nt NT seq  +upstreamnt  +downstreamnt
atgtctggtggggccagcgccacaggcccaaggaggggtcccccaggattggaggaggcc
accagtaagaagaagcagaaggatcgagcaaaccaggagagcaaggatggagatcctagg
agagggtcggcatcttctcgggaggagcaggccaaagaggagttgttgcttgattggagg
cagagtgcagatgaggtgattgtcaagctgcgtgtgggagcaggtcccctgcggctggag
gaagtggatgctgctttcacggacacagactgcgtggtgcggcttccaggtggtcggcag
tggggtggtgttttctacgctgaaatagaaagttcttgcaccaaagtacaagctcgtaaa
ggtggcctcctgcagctggcactgcccaagaaggtgcctctgctcacatggccctctctt
ctgaagaaacctctagggacccaggaggtggtaccagggctgcggtgccaggagaatggg
caggagccatctcccattgctctggagccaggccctgagccccgtcgggctaaacaggag
gcccggaaccagaagcgggcccagggccgtggtgaggtaggcgcaggggctggccccggg
gcccaggcaggccccagcgccaagagggctgtgcatctccgcagagggccagagggggaa
gggtccagagatgggcctggaccccggggtgatgccccccccttcttggctgagacagcc
acccaggcagaagctgaggaacagctccgggtaccaccattgaacccccagacctgcctc
ttgggctcagaggagaatctagcactcttgacaggagaaaagactgtgtctcccaggaat
gacccagtctccccagccatgtcccggagcagagaccctgagaaaggtgaccgttccaaa
gaggagatggcagtggcagcagatgctgtaaccttggtggatggtaaagagccggaatcc
atggtgaacctggcatttgtcaagaatgactcatatgagaaggggccagattccgtggtg
gtgcacgtgtacgtgaaagaaatccgcagggacacctctcgagtgcttttccgcgagcag
gacttcacacttatcttccagaccagggatggaaacttcctgagactacacccgggctgt
gggccccacaccctcttccgttggcaggtgaagctcaggaacctgattgaacctgagcag
tgcaccttctgcttcaccgcctctcgcattgacatctgcctccgtaagcggcaaagtcag
cgctgggggggcctggaggccccagctgcacgaggtgcagtgggtggtgcaaaggttgcc
gtgccgacaggtccaacccctctggattcagcaccaccaggaggcacccctcaccccctc
acaggacaggaggaagctcgggctgtggagaaggaaaaacccaagcctcggtctgaggac
acggggttggatggtgtggctgcccgtacgcccatggagcatgtagccccaaagccagag
ccacacctggcctcgcccaagcccacatgtatggtgcctccaatgccccatagcccagtg
agtggagacagtgtggaggaagaggaggaggaagagaagaaggtgtgtctgccaggcttc
actggccttgtcaacctaggcaacacttgcttcatgaacagtgttattcagtctttgtct
aacactcgggagctccgtgacttcttccatgaccgctcctttgagactgagatcaactac
aacaacccattggggactggtgggcgtctggccattggctttgctgtgctgctccgggcg
ctatggaagggcactcaccatgccttccagccttccaagttgaaggccattgtggcgagc
aaggccagccagttcacaggctatgcacagcatgatgcccaggagttcatggctttcttg
ctggatgggctgcatgaagacctgaatcgcattcagaacaagccatacacagagactgtg
gactcggatgggcggcctgatgaggtggtggctgaagaagcatggcagcggcataagatg
cggaatgactctttcatcgtagacctatttcaggggcagtataagtcgaagctggtgtgc
cctgtgtgtgccaaggtctccatcactttcgacccattcctctacctgccggtacccttg
ccacagaagcagaaggttctccccgtcttctattttgcccgggagccccacagcaagcct
atcaagtttctggtgagcatcagcaaggagaactccagcgcaagtgaagtgttggactcc
ctctctcagagtgtccacgtgaagcctgagaacctgcgtctggctgaggtgataaagaat
cgtttccaccgtgtgttcctgccctcccactcattggacaccgtgtccccatctgacaca
ctcctctgctttgagctgctatccccagagttggctaaggaacgggtggtggtgctagag
gtgcagcagcgcccccaggtgcccagcatccccatctccaagtgtgcagcctgccagcgg
aagcagcagtcagaagatgagaagctgaagcgttgtactcggtgctaccgcgtgggctac
tgcaaccagctctgccagaaaacccactggcctgaccacaagggtctctgccgccctgag
aatattggctacccatttctggtcagtgtacctgcctcacgtctcatttacgctcgtctt
gctcagctgctagagggctatgcccggtactctgtgagtgtattccagccacccttccag
cctggccgcatggccttggagtcccagggccctggctgcactacgttgctctccactagc
tccctggaggctggggacagtgagagggacccgattcagccgcctgagctccagttggtg
acccctgtggctgagggggacacaggggtccctcgggcatgggcggcccctgaccggggc
cctgtgcccagcaccagtggcgtttcttctgaggtgctggccagtgggcctgttgaagtt
ggctccttgcctgctggtgagagggtgtctcggcccgaagctgctgtgcccggatatcag
catccaagtgaagccatgaactcccacacaccccagttcttcatctataaaattgatgca
tctaaccgagagcagcggctagaggacaaaggagacacccccctggagctgggtgaggac
tgtagtctggctctagtctggcgaaacaatgagcgtctacaggagtttgtgttggtagcc
tccaaggagctggaatgtgctgaggatccagggtctgctggtgaggctgcccgtgctggc
cacttcactctggaccagtgcctgaacctcttcactcggcctgaggtgctggcaccggag
gaggcttggtactgcccacagtgtaaacaacaccgagaggcctccaagcaactgttgcta
tggcgccttcctaacgtacttattgttcagctcaagcgcttctcctttcggagtttcatc
tggcgtgacaagatcaatgacttggtggagttccctgttcggaatctggacctgagcaag
ttctgcatcggtcagaaagaggaacagctgcctagctacgacctgtatgctgtcatcaac
cactacggaggcatgattggcggccactacactgcctgtgcgcgtctacccaatgaccgc
agcagccagcgcagcgacgtgggctggcgcttgtttgatgacagcacggtgacaacagta
gacgagagccaggtcgtgacgcgttatgcctatgtactcttctaccgtcggcgaaactct
cctgtggagaggccccccagggcaggtcactctgagcaccacccagacctaggccctgca
gctgaggctgctgccagccaggcttcccggatttggcgggagctggaggccgaggaggaa
ccggtacccgaggggcctgtgcccctgggtccctgggggccccaagactgggtgggcccc
ccaccacgtggccctaccacatcagatgagggctgtctccggtactttgttctgggcacc
gtggcagctttggtggccctcgtgctcaacatgttctatcctctggtatcccagagttgc
tggagatga

DBGET integrated database retrieval system