KEGG   Canis familiaris (dog): 476665Help
Entry
476665            CDS       T01007                                 

Gene name
COMP
Definition
(RefSeq) cartilage oligomeric matrix protein
  KO
K04659  thrombospondin 2/3/4/5
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04145  Phagosome
cfa04151  PI3K-Akt signaling pathway
cfa04510  Focal adhesion
cfa04512  ECM-receptor interaction
cfa05144  Malaria
cfa05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    476665 (COMP)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    476665 (COMP)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    476665 (COMP)
  Cellular community - eukaryotes
   04510 Focal adhesion
    476665 (COMP)
 Human Diseases
  Infectious diseases
   05165 Human papillomavirus infection
    476665 (COMP)
   05144 Malaria
    476665 (COMP)
Membrane trafficking [BR:cfa04131]
 Endocytosis
  Phagocytosis
   Opsonins
    476665 (COMP)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   476665 (COMP)
  Exosomal proteins of colorectal cancer cells
   476665 (COMP)
  Exosomal proteins of bladder cancer cells
   476665 (COMP)
Glycosaminoglycan binding proteins [BR:cfa00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   476665 (COMP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TSP_C TSP_3 COMP EGF_CA EGF_3 cEGF EGF_MSP1_1 hEGF
Motif
Other DBs
NCBI-GeneID: 476665
NCBI-ProteinID: XP_533869
Ensembl: ENSCAFG00000014616
Position
20
AA seq 756 aa AA seqDB search
MVPAAACVLLLTLAALGVSGQGQIPLGADLGPQMLRELQETNAALQDVRELLRQQVKEIT
FLKNTVMECDACGMQPARTPGLSVRPLSQCAPGFCYPGVVCTQTASGARCGPCPAGFTGN
GSHCVDVNECNAHPCFPRVRCINTKPGFRCEACPPGYSGPAHEGVGLAFAKANKQVCTDI
NECETGQHNCVPNSVCVNTRGSFQCGPCQPGFVGDQASGCQRRSQRFCPDGTPSPCHEKA
DCILERDGSRSCVCAVGWAGNGLLCGRDTDLDGFPDEKLRCSERQCRKDNCVTVPNSGQE
DVDRDGIGDACDPDADGDGVLNEQDNCKLVRNPDQRNADGDKWGDACDNCRSQKNDDQKD
TDQDGKGDACDDDIDGDRIRNTVDNCPRVPNSDQKDSDGDGVGDACDNCPQKSNADQRDV
DHDFVGDACDSDQDQDGDGHQDSRDNCPTVPNSAQQDSDHDGQGDACDDDDDNDGVPDSR
DNCRLVPNPNQEDVDRDGVGDACQGDFDADKVVDKIDVCPENAEVTLTDFRAFQTVVLDP
EGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTVTDDDYAGFIF
GYQDSSSFYVVMWKQMEQTYWQANPFRAVAEPGIQLKAVKSSTGPGEQLRNALWHTGDTA
SQVRLLWKDPRNVGWKDKTSYRWFLQHRPQVGYIRVRFYEGPELVADSNVVLDTTMRGGR
LGVFCFSQENIIWANLRYRCNDTIPEDYETQRLLQA
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atggttcctgccgccgcctgcgttctcctgctcaccctggccgccctcggcgtgtcgggt
cagggccagataccactaggtgcagatctaggaccgcagatgcttcgggaacttcaggag
accaacgcggcgctgcaggatgtgcgggagctgttgcggcagcaggtcaaggagatcacg
tttctgaaaaacacagtgatggagtgtgacgcgtgcgggatgcagcccgcgcgcaccccg
gggctgagcgtgcggcccctatcccagtgcgcgcccggcttctgctacccgggcgtggtc
tgcactcagaccgcaagcggcgcgcgctgtggcccctgccccgcgggcttcaccggcaat
ggctcgcactgcgtcgacgtcaacgagtgcaacgcccatccctgcttcccccgcgtccgc
tgcatcaacaccaaacccggcttccgctgcgaggcttgcccgccggggtacagcggcccc
gcccacgagggcgtggggctggccttcgccaaggccaacaagcaggtttgcacggacatt
aacgagtgtgagaccgggcagcataactgcgtccccaactccgtgtgcgtcaacacccgg
ggctccttccagtgcggcccttgccagcccggcttcgtgggcgaccaggcgtctggctgc
cagcggcgctcgcagcgcttctgccccgacggcacgcccagcccgtgccacgagaaggcc
gactgcatcctggaacgcgacggctcgcgatcgtgcgtgtgcgccgttggctgggcaggc
aacgggctcctctgcggccgagacacggatttggacggcttccccgacgagaagctccgc
tgctcagaacgccagtgccgtaaggacaactgtgtgacggtgcccaactcagggcaagag
gacgtggatcgcgacggcatcggagacgcctgcgacccggatgctgatggggacggggtc
ctcaacgagcaggacaactgtaagctggtgcggaacccagaccaacgcaatgcggacggc
gacaagtggggtgatgcttgcgacaactgccggtcccagaagaacgacgaccaaaaggac
acagatcaggacggcaaaggcgacgcctgcgacgacgacatcgacggcgaccggatacga
aatacggtggacaactgcccaagggtacccaactcagaccagaaggacagtgatggtgac
ggtgtaggagatgcctgtgacaactgtccccagaaaagcaacgcagaccagagggatgta
gaccacgactttgtgggagacgcttgtgacagcgaccaagaccaggatggggatgggcac
caggactcacgggacaactgccctacagtaccgaatagtgcccagcaggactcagaccac
gatggtcagggtgacgcctgcgatgacgacgatgacaatgacggagtccccgacagtcgg
gacaactgtcgtcttgtgcccaacccaaaccaggaagatgtagaccgggacggtgtgggc
gatgcgtgccagggcgacttcgacgcggacaaggtggtggacaagattgatgtgtgtccg
gagaatgccgaggtcaccctcaccgacttccgggccttccagactgtcgtactggacccc
gagggcgacgcgcagatagatcccaactgggtggtgctcaaccagggtatggagatcgtg
cagaccatgaacagcgaccctggcctggctgtgggttacacggccttcaatggcgtggac
ttcgaaggcacgttccacgtgaacacagtcacagatgatgactatgctggcttcatcttt
ggctaccaggacagctccagcttctacgtggttatgtggaaacagatggagcagacatac
tggcaggcgaatcccttcagggccgtagctgaacccggcattcagctcaaggctgtgaag
tcctccacaggccccggggagcagctgcggaatgcactctggcacacaggggacacagca
tcacaggtgcggctgctgtggaaggacccccgcaacgtgggttggaaggacaagacatcc
taccgctggttcctgcagcatcggccccaagtgggctacatcagagtgcggttctacgag
ggtcctgagctggtggccgacagcaacgtggtcctggacacaaccatgcggggtggccgc
ctgggggtcttttgcttctcccaagagaacatcatctgggccaatctgcgctaccggtgc
aatgacaccataccagaggactacgagactcagaggcttctgcaggcctag

DBGET integrated database retrieval system