KEGG   Canis familiaris (dog): 476821Help
Entry
476821            CDS       T01007                                 

Gene name
ART1
Definition
ADP-ribosyltransferase 1
Orthology
K06716  
ADP-ribosyltransferase 1 [EC:2.4.2.31]
Organism
cfa  Canis familiaris (dog)
Brite
Enzymes [BR:cfa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     476821 (ART1)
Cellular antigens [BR:cfa04090]
 Proteins
  476821 (ART1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
21
AA seq 321 aa AA seqDB search
MQTPPLMSLLLVSVGLMEALQAQGHPITRRDLFAQEMPLDMAPASFDDQYAGCAAAMTAA
LPDLNQTEFQANKVYADSWALASSQWRHRQAWGPEWGPRPTRLPARPPGFRDEHGVALLA
YTAHSPLHKEFNAAVREAGRSRAHYLNHFSFKTLHFLLTEALQLLGRGQRSPQCHQVFRG
VHGLRFRPAGPGATVRLGGFASASLQNVAAQQFGEDTFFGIWTCLGAPIKGYSFFPGEEE
VLIPPFETFQVINASRPAQGPTRIYLRALGKRSTYNCEYIKDKQCKSRPCRLDNSAMGQG
PPSAVWSLLLPLWFLAGGTFP
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgcagactcctcccctgatgtctctgctgcttgtgtctgtgggcctcatggaagccctt
caggcccagggccaccccatcacccgtcgagacctgttcgctcaggaaatgcccctggac
atggccccagcctccttcgatgaccagtacgctggctgcgcggcagccatgacggccgct
ctccccgacctcaaccaaacggagttccaggccaacaaggtgtacgccgacagctgggcg
ctggcaagcagccagtggcggcaccgccaggcctggggcccggagtggggcccgaggccc
acccggctgcccgcacggccccccggcttccgcgacgagcacggggtggccctcctggcc
tacacagcccacagccccctgcacaaggagttcaacgcggccgtgcgcgaggcgggccgc
tccagagcccactacctcaaccacttctccttcaagacactccatttcctgctgacggag
gccctacagctgctgggcaggggccagcgttcaccccagtgccaccaggtgttccgaggg
gtgcatggcctgcgcttccggccagccggacccggggccaccgtaaggctgggggggttt
gcatctgcatccctgcagaacgtcgcagcccagcagtttggggaggataccttcttcggc
atctggacttgccttggggcacctatcaagggctattccttcttccccggggaggaggag
gtgctgatcccccccttcgagaccttccaggtgatcaatgccagtagaccagcccagggc
cccacccgcatctacctccgggccctgggcaagcgcagcacgtacaactgtgaatacatt
aaagacaagcagtgtaagtctaggccctgccgtctggataactcagccatgggtcaaggc
cccccttctgcagtctggtccctcctactgccgctctggtttcttgccgggggaaccttt
ccatag

DBGET integrated database retrieval system