KEGG   Canis familiaris (dog): 476828Help
Entry
476828            CDS       T01007                                 

Gene name
PDK1
Definition
pyruvate dehydrogenase kinase, isozyme 1
Orthology
K12077  
pyruvate dehydrogenase kinase isoform 1 [EC:2.7.11.2]
Organism
cfa  Canis familiaris (dog)
Pathway
HIF-1 signaling pathway
Class
Environmental Information Processing; Signal transduction; HIF-1 signaling pathway [PATH:cfa04066]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
36
AA seq 369 aa AA seqDB search
MRREAGYNWPERFTECLPCHLLNSVSIRGTFVSSSARSMNACEKTSFMFLRQELPVRLAN
IMKEISLLPDNLLRTPSVQLVQSWYIQSLQELLEFKDKSAEEAKTIYDFTDTVIRIRNRH
NDVIPTMAQGVIEYKESFGVDPVTSQNVQYFLDRFYMSRISIRMLLNQHSLLFGGKGKGS
PAHRKHIGSINPNCDVVEVIKDGYENARRLCDLYYINSPELELEELNAKSPGQPIQVVYV
PSHLYHMVFELFKNAMRATMEHHADKGVYPPIQVHITLGNEDLTVKMSDRGGGVPLRKID
RLFNYMYSTAPRPRVETSRAVPLALSTESIERLPVYNKAAWKHYNTNHEADDWCVPSREP
KDMTTFRSA
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgagacgggaggcaggttataactggcccgagcgtttcacagaatgtttgccttgccac
ttgcttaatagtgtttccatccgcggcacattcgtttcatcatcagcaagatctatgaac
gcttgtgaaaagacctcatttatgtttctgcgacaagagctacctgttagattggcaaat
ataatgaaagaaataagtcttcttccagataatcttctcaggactccatcagttcaattg
gtacaaagctggtatatccagagtcttcaggaacttcttgaatttaaagacaaaagtgct
gaagaggctaaaactatttatgactttacagatactgtgattcggatcaggaatcgacac
aacgatgttattcccacgatggcgcagggtgtgattgaatacaaggagagcttcggggtg
gatcctgtcaccagccagaatgttcagtactttttggatcgcttctacatgagtcgcatt
tcaattagaatgttactcaatcagcactctttattgtttggtggaaaaggcaaaggaagc
ccagctcatcgaaaacacattggaagcataaatccaaactgcgatgtagttgaagttatt
aaagatggctatgaaaatgctaggcgtctgtgtgatttgtattatattaactctcctgaa
ctagaacttgaagaattaaatgcaaaatcaccaggacagccaatacaagtggtttatgta
ccatcccatctctatcacatggtgtttgaacttttcaagaatgcgatgagagcaacgatg
gaacaccatgctgacaaaggcgtttaccctcctattcaagtccacatcacactgggtaat
gaggatttgactgtgaagatgagtgaccgaggaggtggtgttcctttgaggaaaattgac
agactcttcaactacatgtactcaacggcaccccggcctcgtgttgagacgtccagagct
gtgcccctggctctgtcaacagaatcaatagagagactgccagtgtataacaaggctgcc
tggaagcattacaataccaaccatgaggctgacgactggtgtgtccccagcagagaacca
aaagacatgacaacatttcgcagtgcctag

DBGET integrated database retrieval system