KEGG   Canis familiaris (dog): 477039Help
Entry
477039            CDS       T01007                                 

Gene name
TGFBR2
Definition
transforming growth factor, beta receptor II (70/80kDa)
Orthology
K04388  
TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
cfa  Canis familiaris (dog)
Pathway
MAPK signaling pathway
Cytokine-cytokine receptor interaction
FoxO signaling pathway
Endocytosis
TGF-beta signaling pathway
Osteoclast differentiation
Hippo signaling pathway
Adherens junction
Chagas disease (American trypanosomiasis)
HTLV-I infection
Pathways in cancer
Transcriptional misregulation in cancer
Colorectal cancer
Pancreatic cancer
Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    477039 (TGFBR2)
   04350 TGF-beta signaling pathway
    477039 (TGFBR2)
   04390 Hippo signaling pathway
    477039 (TGFBR2)
   04068 FoxO signaling pathway
    477039 (TGFBR2)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    477039 (TGFBR2)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    477039 (TGFBR2)
  Cell communication
   04520 Adherens junction
    477039 (TGFBR2)
 Organismal Systems
  Development
   04380 Osteoclast differentiation
    477039 (TGFBR2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    477039 (TGFBR2)
   05202 Transcriptional misregulation in cancers
    477039 (TGFBR2)
   05210 Colorectal cancer
    477039 (TGFBR2)
   05212 Pancreatic cancer
    477039 (TGFBR2)
   05220 Chronic myeloid leukemia
    477039 (TGFBR2)
  Infectious diseases
   05166 HTLV-I infection
    477039 (TGFBR2)
   05142 Chagas disease (American trypanosomiasis)
    477039 (TGFBR2)
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     477039 (TGFBR2)
Protein kinases [BR:cfa01001]
 Serine/threonine protein kinases: TKL group
  TGFBR2 family [OT]
   477039 (TGFBR2)
Enzyme-linked receptors [BR:cfa01020]
 Receptor serine/threonine kinases
  Type II TGF-beta receptor
   477039 (TGFBR2)
Cytokine receptors [BR:cfa04050]
 TGF-beta receptors
  Type II TGF-beta receptor
   477039 (TGFBR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
23
AA seq 561 aa AA seqDB search
MMCHVTPSYAERSCPCSLPLVNDFLVNNDMMVTDSNGVIKFPQLCKFCDVRSSTCDNQKS
CMSNCSITSICEKPHEVCLAVWRKNDENITLETLCHDPKDTYHGIVLEDAASSKCIMKEK
KVLGETFFMCSCSSDECNDYIIFSEEYATNNPDLLLVIFQVTGVSLLPPLGIAIAVIVTF
YCYRVHRQQKLSPSWETSKPRKLMEFSEHLAIILEDDRSDISSTCANNINHNTELLPIEL
DTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFPYEEYASWKTEKDIFSDINLKHENILQ
FLTAEERKTELGKQYWLITAFHAKGNLQEYLTRHVISWEDLRKLGSSLARGIAHLHSDHT
LCGRPKMPIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDPTLSVDDLANSGQVGTARYMA
PEVLESRMNLENVESFKQTDVYSMALVLWEMTSRCNAVGEVKDYEPPFGSKVREHPCVES
MKDNVLRDRGRPEIPSSWLNHQGIQMVCETLTECWDHDPEARLTAQCVAERFSELEHLDR
LSGRSCSEEKIPEDGSLNTTK
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgatgtgccatgtgaccccatcatatgctgaaagaagctgcccatgctcacttccttta
gtgaatgactttctagttaataatgacatgatggtcactgacagcaatggtgtcatcaaa
tttccacaattgtgtaaattttgtgatgtgagatcttccacctgtgacaaccagaaatct
tgcatgagcaactgcagcattacatccatctgtgagaagccacatgaagtctgtctggct
gtctggagaaagaatgatgagaacataacactagagactctctgccatgaccccaaggat
acctaccatggaattgttctcgaagatgctgcctcttcgaagtgcattatgaaagaaaag
aaggtgctgggggagactttctttatgtgttcctgtagctccgacgagtgcaacgactac
atcatcttctctgaagaatatgccaccaacaaccctgacttgttgttagtcatattccaa
gtgacaggcgtcagcctcctgccgcccctgggaatcgccatagccgtcattgtcaccttc
tactgttaccgcgttcatcggcagcagaagctgagcccatcatgggagaccagcaagcca
cggaagctcatggagttcagcgagcacctggccatcattctggaagacgaccggtccgac
atcagctctacctgcgccaacaacatcaaccacaacacggagctgctgcccattgagctg
gacaccctggtggggaaaggtcgctttgctgaggtctacaaggccaagctgaagcagaac
acttcagagcagttcgagactgtggcagtcaagatcttcccttacgaggagtatgcctcc
tggaagacggagaaggacatcttctcagacatcaatctgaagcacgagaacatactgcag
ttcctgacagccgaggagcggaagacggagctgggaaagcagtattggctgatcacggcc
ttccatgccaagggcaacctgcaggagtacctcactcggcatgtcatcagctgggaggac
ctgcgaaagctgggcagctccctcgcccggggcattgctcacctgcacagtgaccacacc
ctgtgtgggaggcccaagatgcctattgtgcacagggacctcaagagctccaatatcctg
gtgaagaacgacctgacctgctgcctgtgtgactttggcctttccctgcgcctggaccca
actctgtctgtggatgacctggccaacagtgggcaagtgggaactgcaagatacatggct
cccgaagtcctagagtccaggatgaatttggagaacgttgaatcctttaagcagactgat
gtctactccatggccctggtactctgggaaatgacatctcgctgtaatgcagtgggagaa
gtgaaagattatgagcccccgtttggttccaaggtgcgagagcatccctgcgttgagagc
atgaaggacaatgtgctgagagaccgaggacgaccagaaattcccagctcctggctcaac
caccagggcatccagatggtgtgcgagactctgaccgagtgctgggaccacgacccggag
gcccggctcacggcccagtgcgtggcggagcgcttcagtgaactggagcacctggacagg
ctctcagggaggagctgctctgaggagaagattcccgaagatggctcgctgaacactacc
aaatag

DBGET integrated database retrieval system