KEGG   Canis familiaris (dog): 477052Help
Entry
477052            CDS       T01007                                 

Gene name
KAT2B, PCAF
Definition
K(lysine) acetyltransferase 2B
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
cfa  Canis familiaris (dog)
Pathway
Notch signaling pathway
Thyroid hormone signaling pathway
HTLV-I infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    477052 (KAT2B)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    477052 (KAT2B)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    477052 (KAT2B)
  Infectious diseases
   05166 HTLV-I infection
    477052 (KAT2B)
Enzymes [BR:cfa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     477052 (KAT2B)
Transcription machinery [BR:cfa03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     477052 (KAT2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
23
AA seq 777 aa AA seqDB search
MNMNTIEKNIKYNVIVSLPLPAEESCKCNGWKNPNPSPTPPRADLQQIIVSLTESCRSCS
HALVQRSRDMLAARPAAACSHCRACEDWQAVLKRSAGHFHSHGGDQPYSYVETQELNTVK
KQKETHKYKMMVARGVELLRKSILQRGKPVVEGSLEKKPPFEKPSIEQGVNNFVQYKFSH
LPSKERQTIVELAKMFLNRINYWHLEAPSQRRLRSPNDDISGYKENYTRWLCYCNVPQFC
DSLPRYETTQVFGRTLLRSVFTVMRRQLLEQARQEKDKLPLEKRTLILTHFPKFLSMLEE
EVYSQNSPIWDQDFLSASTRTSQLGIQTVISPPPVAGTISYNSNSSSLEQPNGGSTSPSC
KGSSGLEANPGEKRKMNDSHALEEAKKPRVMGDIPMELIDEVMSTITDPAAMLGPETNFL
SAHSARDEAARLEERRGVIEFHVVGNSLNQKPNKKILMWLVGLQNVFSHQLPRMPKEYIT
RLVFDPKHKTLALIKDGRVIGGICFRMFPSQGFTEIVFCAVTSNEQVKGYGTHLMNHLKE
YHIKHDILNFLTYADEYAIGYFKKQGFSKEIKIPKTKYVGYIKDYEGATLMGCELNPRIP
YTEFSVIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKDGVRQIPIESIPGIRETGWKPSG
KEKSKEPKDPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSE
RLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLIDK
NT seq 2334 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgaataccatagagaagaatataaagtacaatgtgattgtctctcttcctctt
cccgccgaggagtcttgtaaatgtaatggctggaaaaatcccaacccttctcccactccc
cccagagctgatctgcagcaaataatcgtcagtctaacagaatcctgccggagttgtagc
catgccctagtccaaaggagcagagacatgttagctgcccgcccagctgctgcctgttca
cactgcagggcatgtgaggactggcaggctgtcctcaagagaagtgcaggccactttcac
agccatggtggagaccagccatattcttatgtggaaacacaggaattaaacactgtcaaa
aagcagaaagagacccataagtacaaaatgatggttgccagaggagtggagctcttgaga
aagtctattttacaaagaggaaaacctgtggttgaaggctctttggagaagaaaccccca
tttgaaaaacctagtattgaacagggtgtgaataactttgtacagtacaaatttagtcac
ctgccatccaaagaaaggcaaacaatagttgagttggcaaaaatgttcctaaaccgcatc
aactattggcacctggaggcaccatctcaacgaagactgcgatctcccaatgatgatatt
tctggatacaaagagaactacacaaggtggctgtgttattgcaatgtgccccagttctgt
gacagtctacctcgctatgaaaccacccaggtgtttgggagaacactgctgcgctcagtc
ttcacagtcatgagaagacaactcctggaacaagcgagacaggagaaagacaaactgcca
cttgaaaaaagaactctcatcctgacccatttcccaaagtttctgtccatgttagaagaa
gaagtttatagtcaaaactctcctatctgggatcaggattttctctcagcctctaccaga
accagccagctaggaatccaaacagttatcagtccacctcctgtagctgggaccatttca
tataattcaaactcatcttcccttgagcaacctaatggagggagcaccagtccttcctgc
aaaggctcttctgggcttgaggcaaacccaggagaaaagaggaaaatgaatgactctcat
gccttggaggaggccaagaaacctcgagttatgggggatattccaatggaattaattgac
gaggttatgtctaccatcacagaccctgcagcaatgcttggaccagagaccaatttcttg
tcagcgcattcagccagggatgaggcagcaaggctggaggagcgcaggggtgtgattgaa
tttcatgtggtcggcaattccctgaaccagaaacccaacaagaagattctaatgtggcta
gtaggtctacagaacgtgttctcacaccagctgccccggatgccaaaagagtacatcaca
cggcttgtctttgacccgaaacacaaaacccttgccctaattaaagatggccgtgtcatt
ggtggtatctgtttccgtatgttcccatcccaaggattcacagagattgttttctgtgct
gtaacctcaaatgagcaagtcaagggctatggaacacacctgatgaatcacttgaaagaa
tatcatataaaacatgatatcctgaacttccttacatatgcagatgaatatgctattggt
tatttcaagaaacagggtttctccaaagaaattaaaatacctaaaaccaaatatgttggc
tacatcaaggattatgaaggggccactttaatgggatgtgagctaaatccccggatccca
tacacagaattttctgtcatcattaagaagcaaaaggagatcattaaaaagctgatagaa
agaaaacaagcccagattcgaaaagtataccctggactttcctgtttcaaagatggagtt
cgacagatcccaatagaaagcattcctggaattagagagacaggctggaagccgagtgga
aaagagaaaagtaaagagcccaaagaccctgaccagctttacagcactctcaagagcatc
ctccagcaggtgaagagccatcaaagcgcttggcccttcatggaacctgtgaagagaaca
gaagctccgggatattatgaagttataaggttccccatggatctgaaaaccatgagtgaa
cggctcaagaataggtactacgtgtctaagaaattattcatggcagacttacagcgagtc
tttaccaattgcaaagagtacaacccccctgagagtgaatactacaaatgtgccaatatc
ctggagaaattcttcttcagtaaaattaaggaagctggattaattgacaagtaa

DBGET integrated database retrieval system