KEGG   Canis familiaris (dog): 477371Help
Entry
477371            CDS       T01007                                 

Gene name
PBK
Definition
PDZ binding kinase
Orthology
K08865  
PDZ-binding kinase [EC:2.7.12.2]
Organism
cfa  Canis familiaris (dog)
Brite
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     477371 (PBK)
Protein kinases [BR:cfa01001]
 Serine/threonine protein kinases: Other group
  TOPK family
   477371 (PBK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
25
AA seq 324 aa AA seqDB search
MEEINNFKTPSKLSEKKKSALCSTPCINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSP
WAVKKINPKCNDHYQSMYQKRLIDEAKILKNLHHPNIVGYRAFTEASDGSLCLAMEYGGE
KSLNDLIEERNKDSQDPFPAAIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFE
TIKICDVGVSLPLDENMTVTDPEACYIGTEPWKPKEALEENGIITDKADIFAFGLTLWEM
MTLSIPHINLPDDDDDDEDKTFDESDFDDEAYYAALGTRPPVNMEELDETYQKVIELFSV
CTNEDPKDRPSAAHIVEALEIDVQ
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaatcaataatttcaagacaccaagcaaattatcagaaaaaaagaaatctgca
ttatgttcaactccatgtataaatattcctgcctctccatttatgcagaagcttggcttt
ggtactggggtaaatgtgtaccttatgaaaagatctccaagaggcttgtctcattctcct
tgggctgtgaaaaagattaaccctaaatgtaatgatcattaccaaagtatgtatcaaaag
agattaatagatgaagctaagattttgaaaaacctccatcacccaaacattgtaggttat
cgtgccttcactgaagccagtgatggtagtctatgtcttgctatggaatatggaggtgaa
aagtctctaaatgacttaatagaagaacgaaataaagacagccaagatccttttccagca
gccataattttaaaagttgctttgaacatggcaagagggttaaagtatctacaccaagaa
aagaaactgcttcatggagacataaagtcttcaaatgttgtaattaaaggtgattttgaa
acaattaaaatctgtgatgtaggagtctctctgccacttgatgaaaatatgactgtgact
gatcctgaggcctgttacattggcaccgagccttggaaacccaaggaagctttggaagag
aatggcattattactgacaaggcagacatatttgcctttggcctgactctgtgggaaatg
atgactttgtctattccacacattaatcttccagatgatgatgatgatgatgaagataaa
acttttgatgaaagcgactttgatgatgaagcatactatgcagctttggggacgaggcca
cctgttaatatggaagaactggatgaaacgtaccagaaagtaattgaacttttctctgta
tgcactaacgaagatcctaaagatcgtccttctgccgcacacatcgtggaagctttggaa
atagatgtccagtga

DBGET integrated database retrieval system