KEGG   Canis familiaris (dog): 477568Help
Entry
477568            CDS       T01007                                 

Gene name
CLTCL1
Definition
clathrin, heavy chain-like 1
Orthology
K04646  
clathrin heavy chain
Organism
cfa  Canis familiaris (dog)
Pathway
Lysosome
Endocytosis
Synaptic vesicle cycle
Endocrine and other factor-regulated calcium reabsorption
Huntington's disease
Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    477568 (CLTCL1)
   04142 Lysosome
    477568 (CLTCL1)
 Organismal Systems
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    477568 (CLTCL1)
  Nervous system
   04721 Synaptic vesicle cycle
    477568 (CLTCL1)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    477568 (CLTCL1)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    477568 (CLTCL1)
Exosome [BR:cfa04147]
 Exosomal proteins
  Proteins found in most exosomes
   477568 (CLTCL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
26
AA seq 1675 aa AA seqDB search
MTSLCHLSGDVIPFLQLQNLGINPANIGFSTLTMESDKFICVREKVGEQAQVVIIDMSEP
MVPIRRPISAESAIMNPASKVIALKAGKTLQIFNIEMKSKMKSHTMAEEVIFWKWVSVNT
VALVTETTVYHWSMEGDSQPVKMFDRHASLSGCQMIHYRTDEYQKWLLLIGISAQQNRVV
GAMQLYSVDRKVSQPIEGHAAAFAEFKSEGNTKPATLFCFAVRSPTGGKLHIIEVGQPAA
GNQPFVKKAVDVFFPPEAQTDFPVAMQIGAKHGVIYLITKYGYLHLYDLESGVCIYMNRI
SADTIFVTAPHEPTSGIIGVNKKGQVLSICVEEDNIVNYATTVLQNPDLGLRLAIRSNLA
GAEELFVRKFSTLFAQGSYAEAAKVAASAPKGVLRTSDTVRKFQSIPAQPGQASPLLQYF
GILLDQGQLNKLESLELCRPVLQQGRKQLLEKWLKEDKLECSEELGDLVKTADPTLALSV
YLRANVPSKVIQCFAETGQFQKIVLYAKKVGYVPDWIFLLRSVMRISPDQGLQFSQMLVR
EEEPLANIDQIVDVFMENSLIQQCTSFLLDALKNNRPAEGHLQTRLLEMNLIHAPQVADA
ILGNQMFTHYDRAHIAQLCEKAGLLQRALEHYTDLYDIKRAVVHTHLLNPEWLISFFGSL
SVEDSLACLHALLSASIRQNLQLCVQVASKYHEQLGTQSLVELFESFKSYEGLFYFLGSI
VNFSQDPDVHLKYIQAACKTGQIKEVERICRESNCYNPERVKNFLKEAKLTDQLPLIIVC
DRFDFVHDLVLYLYRNNLQKYIEIYVQKVNPSRIPAVVGGLLDVDCSEEVIKNLIMVVRG
QFSTDELVAEVEKRNRLKLLLPWLESRSHEGCEEPATHNALAKIYIDSNNSPERFLRENA
YYDSRVVGRYCEKRDPHLACVAYERGQCDLELIKVCNENSLFKSEARYLVRRKDPELWAH
VLEETNPSRRQLIDQVVQTALSETQDPEEVSVTVKAFMTADLPNELIELLEKIVLDNSVF
SEHRNLQNLLILTAIKADRTRVMEYISRLDNYDAPDIANIAVSSALYEEAFAIFRKFDVN
ASAIQVLIEHIGNLDRAYEFAERCNEPAVWSQLARAQLQKDLVKESIDSYIRADDPSSYL
EVVQAASKSNNWEDLVKFLQMARKKGRESYVETELIFALAKTSRLSELEDCINGPNNAHI
QQVGDRCYEEGMYEAAKLLYSSVSNFARLASTLVHLGEYQAAVDSSRKANSTRTWKEVCF
ACVDGQEFRLAQLCGLHIVIHADELEELIHYYQDRGYFEELISLLEAALGLERAHMGMFT
ELAILYSKFKPQKMPEHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDNAVLTM
INHPTDAWREGQFKDVIAKVANVELYYKALQFYLDYKPLLLNDLLLVLAPRLDHTRTVGF
FSKAGQLPLVKPYLRSVQSHNNKSVNEALNHLLTEEEDYQGLRASIDAYDNFDNIALAQR
LEKHQLIEFRRIAAYLYKGNSRWAQSVELCKKDHLYKDAMQHAAESRDAELAEKLLQWFL
EEGKRECFAASLFTCYDLLPPDVVLELAWRHNLVDLAMPYFIQVMREYLSKVDRLDASES
LRKREEHVVEPAPLLFGQQLMLTAGPAAGPAPAGFPYGYTAAPAFAQPPVYGFSV
NT seq 5028 nt NT seq  +upstreamnt  +downstreamnt
atgacaagcctgtgtcacctgagcggtgatgtgattccctttttacagctccagaacctg
ggaattaatccagccaacattggatttagcacactgaccatggaatctgataagtttata
tgtgtccgagagaaggttggcgaacaggcgcaagtagtgattattgacatgagtgagcca
atggtgccaatcagacggcccatctctgctgagagtgccatcatgaatccagcctctaag
gtgatagctctgaaagctgggaagacacttcagatctttaatattgaaatgaagagtaaa
atgaagtctcatacaatggcagaagaggtgattttctggaaatgggtctctgtgaacact
gttgccctggtgactgagaccacagtctaccactggagcatggaaggtgactctcaaccc
gtgaagatgtttgatagacatgccagtctgtcagggtgccagatgatccactaccggact
gatgagtaccagaagtggttgctcctcattggcatctcagctcagcaaaaccgtgtagtt
ggggcaatgcagctctactctgtggataggaaggtttcacaacccatagaaggccatgct
gctgcttttgcagagttcaagagcgaggggaacaccaagcctgccacccttttctgcttt
gctgtacgaagtcccacagggggcaagttgcacataattgaagtcgggcagcctgcagca
ggaaaccagccttttgtaaagaaagctgtggatgtgtttttccctccagaggctcagact
gatttcccagtggctatgcagattggagctaaacatggagttatttacttgatcacaaag
tatggctatcttcatctgtatgacctagagtctggcgtgtgcatttacatgaaccgtatt
agtgctgacacaatttttgtcactgctccacatgaacctacttctggaattatcggtgtc
aacaaaaagggacaggtgctgtccatttgtgtcgaggaagataacattgtgaattatgca
accactgtgcttcagaatccagaccttggtctgcgtttggccattcgtagcaacttggct
ggggcagaggaattatttgtgagaaaattcagtaccctctttgcgcaggggagctatgct
gaagctgcgaaagtagcagcatctgcaccaaagggagtcctgcgtaccagtgacacagtt
cggaagttccagagtattcctgcccagccggggcaggcctctcctttgctccagtacttt
ggaatcctgcttgaccagggtcagctcaataaacttgaatccttagaactttgccgtcca
gtgcttcagcagggacgaaagcaactcttagaaaagtggctgaaagaagataagctggag
tgttcagaagaacttggagatttggtcaaaactgctgaccctacactcgctctgagtgta
tatcttcgggcaaatgtgccaagcaaagttatccaatgttttgcagaaacaggccaattc
cagaaaattgtcctctatgccaaaaaggttggctatgtcccagactggatctttttgcta
agaagtgtaatgaggatcagtccagaccagggcctgcagttttctcagatgctagtgcga
gaggaagagccattggccaatattgaccagattgtagatgttttcatggaaaacagttta
attcagcagtgtacttccttcttattggatgctttgaaaaataatcgcccagctgagggg
cacctccagactcgcctgttggagatgaacctgattcatgcaccccaggttgcagatgcc
attcttggaaatcagatgtttactcattatgatcgggcccacattgcccagctctgtgaa
aaggcaggcctcctgcagcgtgcattggagcactacactgacctctacgacatcaagagg
gctgtggtccacactcaccttctcaatcctgagtggctcatcagcttctttggctccttg
tcggttgaggattctttggcgtgtctgcatgctctgctgtctgccagtatcagacagaac
cttcagctgtgtgtgcaggtagcctccaagtaccacgagcagctgggcacacagtccctg
gtggagctctttgaatccttcaagagttacgaaggcctcttctacttcttgggctcaatt
gtgaacttcagccaagatccagatgtgcacttgaaatacattcaggctgcctgtaagacg
gggcagatcaaggaggtggagaggatatgccgggagagtaattgctacaatccagagcga
gtgaagaatttcctgaaggaggccaagctcacagaccagcttcccctcatcattgtgtgt
gatcggtttgactttgtccatgacctcgtcttgtacttataccgcaacaacctgcagaag
tacatcgagatctacgttcagaaggtcaaccctagccggatccctgctgtggttggaggg
ctgcttgatgtggattgttctgaggaagtaattaaaaacttaatcatggtggtgagagga
cagttctctactgatgagctggtggctgaagtagaaaaaagaaacaggctaaagctgctg
cttccctggctggagtcccggagtcacgaaggctgtgaagagcctgccactcacaatgca
cttgccaagatctacattgatagcaacaatagccccgagcgcttcctgagagagaatgct
tactatgacagccgtgtggtgggccgctactgtgagaaacgggacccacatctggcctgc
gttgcctacgagagggggcagtgtgatcttgaactcattaaggtttgcaatgagaattct
ctgttcaagagtgaggcccgctacctggtgcgcaggaaggatcctgagctctgggctcat
gtccttgaggagactaacccgtccaggagacagctgattgaccaggtggtacagacggca
ttgtcagaaacacaggatcctgaagaggtctcagtcactgtcaaagccttcatgacagct
gatctgcctaatgaactgattgagctgctggagaagattgttctggataactcggtcttc
agtgagcacaggaatctccagaatctgctgatcctaaccgccattaaggcagaccgcaca
cgggtcatggagtacatcagccgcctggacaactacgatgccccagacattgcaaacatc
gccgtaagcagcgcactgtatgaggaggcctttgccattttccgcaagtttgatgtaaac
gcctcagcaatccaggtcctgattgagcacattggaaacctggaccgagcatacgagttt
gcagagagatgtaatgagcctgctgtatggagtcagctggcccgcgcccagctccagaaa
gacttggtgaaagaatccatcgactcctacatcagagcggacgacccttcctcttactta
gaggtcgttcaggcagccagcaagagcaacaattgggaggatctggttaaatttctacag
atggccaggaaaaagggccgagaatcctatgtagagactgaacttatttttgccctggct
aaaaccagccgtctgtctgaactagaagattgtattaatggacccaacaatgcccacatc
cagcaggttggagaccgctgttacgaggagggaatgtatgaagctgccaagctgttgtac
agcagcgtttctaactttgcccgcctagcttccaccctggtccacctcggggaatatcag
gcagcagtggacagcagccgcaaggccaacagcacccgcacgtggaaggaggtgtgcttt
gcatgtgtggatgggcaggagttccgccttgcacagctgtgtggtcttcacattgtcatt
cacgcagatgagctggaggagctgatacactattaccaggatcggggatactttgaggaa
ctgatctctctgctggaggctgccctgggcctggagcgagcccacatgggcatgttcaca
gagctggccatcctctactccaaattcaagcctcagaagatgccagagcacctggagctt
ttctggtcccgagtcaacatcccaaaggtgctgagagcggcagagcaggcgcatctctgg
gcagagctggtgttcctctatgacaagtatgaggagtatgacaatgccgtccttaccatg
atcaatcaccctactgacgcctggagggaaggacagttcaaggacgtcattgccaaggtt
gccaatgtggagctctactataaagcccttcagttctatttggattacaaacctctgctc
ctcaatgacctgttgcttgtgctggcgccccggctagaccatacccggactgttggcttc
ttttcaaaggcaggccagttgcccctagtgaagccttacctgcggtcagtccagagccac
aacaacaagagtgtgaatgaggctctcaaccacctactgacggaagaggaggattaccag
ggtttgagggcatctatcgatgcctacgacaactttgacaacatcgccctggcacagcgg
ttggagaagcaccagctgattgagttcaggcgcattgcagcttatctatacaagggcaac
agccggtgggcccagagtgtggagctctgcaagaaggaccatctctacaaggatgccatg
cagcatgctgcagaatccagggatgctgagctggctgagaagttgctgcagtggttcctg
gaggagggcaagcgagagtgcttcgcagcctctctcttcacctgctatgacctgcttccc
ccagatgtggtgctggagctggcctggagacacaaccttgtggacctggccatgccctac
ttcatccaggtgatgagagagtaccttagcaaagtagacagactagacgcctcagagagc
ctgcgcaagcgagaggagcatgtggtggagcctgcccctctcctatttggccagcagctg
atgctgacagcaggccctgctgcaggccctgctcctgctggcttcccctatggatatact
gctgcacctgccttcgcccagcctcctgtgtacggcttcagcgtgtag

DBGET integrated database retrieval system