KEGG   Canis familiaris (dog): 477586Help
Entry
477586            CDS       T01007                                 

Gene name
STAMBPL1
Definition
(RefSeq) STAM binding protein-like 1
  KO
K11867  
AMSH-like protease [EC:3.4.19.12]
Organism
cfa  Canis familiaris (dog)
Brite
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     477586 (STAMBPL1)
Peptidases [BR:cfa01002]
 Metallo Peptidases
  Family M67
   477586 (STAMBPL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
26
AA seq 436 aa AA seqDB search
MDQPFTVASLRRLAALPDHTDVSLSPEERVRALSKLGANIAITEDIAPRRYFRSGVEMER
MASVYLEEGNLENAFVLYNKFITLFVEKLPSHRDYQQCAVPEKQDIMKKLKEIAFPRTDE
LKKDLLKKYNVEYQEYLQSKNKYKAEILKQLEHQSLIEAERKRVARMRQQQLESEQFLFF
EDQLKKQELARGQMRSQEGPAPPEQIDGGAVSCFSAQREESLLGAFADLPAPSRAASCAG
HSPPVTRALKPAATLSAVQNLVVEGLRRVVLPRDLCHKFLLLAESNTVRGIETCGILCGK
LMHNEFTITHVIVPKQSAGPDYCDVENVEELFGVQDQHGLLTLGWIHTHPTQTAFLSSVD
LHTHCSYQLMLPEAIAVVCSPKHKDTGIFRLTNAGMLEVSACKKKGFHPHTKDPRLFSVC
KHVLIKDIKITMLDLR
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggaccagccgttcaccgtggcctccctgaggaggctggcggccctgcccgaccacacg
gacgtgtcgctgagcccagaggagcgcgtccgcgccctgagcaagctcggggccaacatc
gccatcacggaggacatcgccccgcgccgctacttccggtccggggtggagatggagagg
atggcgtctgtgtacctggaggaggggaacctggaaaacgcctttgtcctgtacaataaa
ttcataaccttgttcgtggaaaagcttcccagccatcgagattaccagcaatgtgcggtc
cccgagaagcaggatattatgaagaaactgaaggagattgcattcccgaggacagatgaa
ttgaaaaaggaccttttaaagaaatataatgtagagtaccaagaatatttgcaaagcaaa
aacaagtataaggccgaaatcctgaaacagctggagcatcagagcctgatcgaggccgaa
aggaagcgggtggcccggatgcggcagcagcagctggagtcggagcagttcctgttcttc
gaggaccagctcaagaagcaagaattagctcggggccagatgcggagccaggaaggcccg
gcgccgccggagcagatcgacgggggcgccgtgtcctgcttctccgcgcagcgcgaagag
tccctgctcggtgccttcgcagacctgcccgctcccagccgcgccgccagctgtgccggc
cactctccgcccgtgacccgggccctgaagcctgccgccaccctgagcgccgtgcagaac
ttagtggttgaaggcctgcggcgtgtagttttaccgagagacctttgccacaaatttctg
ctgctggcggaatctaatacagtgagaggaatagaaacctgtggaattctctgtggaaaa
ctgatgcacaatgaattcaccatcacgcatgtgatcgtgccaaagcagtctgcggggccg
gactactgcgatgtggagaacgtggaggaactattcggcgtgcaggaccaacacggcctc
ctcacgctgggctggatccatacgcatcctacgcagactgccttcttgtccagcgtggac
ctgcacacccactgctcctaccagctcatgctgcccgaggcgattgccgtcgtctgctcc
ccgaagcacaaggacactggcattttcaggctcaccaacgccggcatgcttgaggtctcc
gcttgtaaaaagaagggctttcacccacacaccaaggaccccaggctgttcagcgtctgc
aaacatgtgttgataaaagacataaaaataaccatgctggatctaaggtga

DBGET integrated database retrieval system