KEGG   Canis familiaris (dog): 477625Help
Entry
477625            CDS       T01007                                 

Gene name
ADCY6
Definition
(RefSeq) adenylate cyclase 6
  KO
K08046  adenylate cyclase 6 [EC:4.6.1.1]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00230  Purine metabolism
cfa01522  Endocrine resistance
cfa04015  Rap1 signaling pathway
cfa04022  cGMP-PKG signaling pathway
cfa04024  cAMP signaling pathway
cfa04062  Chemokine signaling pathway
cfa04072  Phospholipase D signaling pathway
cfa04114  Oocyte meiosis
cfa04211  Longevity regulating pathway
cfa04213  Longevity regulating pathway - multiple species
cfa04261  Adrenergic signaling in cardiomyocytes
cfa04270  Vascular smooth muscle contraction
cfa04371  Apelin signaling pathway
cfa04540  Gap junction
cfa04611  Platelet activation
cfa04713  Circadian entrainment
cfa04714  Thermogenesis
cfa04723  Retrograde endocannabinoid signaling
cfa04724  Glutamatergic synapse
cfa04725  Cholinergic synapse
cfa04727  GABAergic synapse
cfa04742  Taste transduction
cfa04750  Inflammatory mediator regulation of TRP channels
cfa04911  Insulin secretion
cfa04912  GnRH signaling pathway
cfa04913  Ovarian steroidogenesis
cfa04914  Progesterone-mediated oocyte maturation
cfa04915  Estrogen signaling pathway
cfa04916  Melanogenesis
cfa04918  Thyroid hormone synthesis
cfa04921  Oxytocin signaling pathway
cfa04923  Regulation of lipolysis in adipocytes
cfa04924  Renin secretion
cfa04925  Aldosterone synthesis and secretion
cfa04926  Relaxin signaling pathway
cfa04927  Cortisol synthesis and secretion
cfa04928  Parathyroid hormone synthesis, secretion and action
cfa04934  Cushing's syndrome
cfa04961  Endocrine and other factor-regulated calcium reabsorption
cfa04962  Vasopressin-regulated water reabsorption
cfa04970  Salivary secretion
cfa04971  Gastric acid secretion
cfa04972  Pancreatic secretion
cfa04976  Bile secretion
cfa05032  Morphine addiction
cfa05166  HTLV-I infection
cfa05200  Pathways in cancer
cfa05414  Dilated cardiomyopathy (DCM)
Module
cfa_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    477625 (ADCY6)
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    477625 (ADCY6)
   04371 Apelin signaling pathway
    477625 (ADCY6)
   04072 Phospholipase D signaling pathway
    477625 (ADCY6)
   04024 cAMP signaling pathway
    477625 (ADCY6)
   04022 cGMP - PKG signaling pathway
    477625 (ADCY6)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    477625 (ADCY6)
  Cellular community - eukaryotes
   04540 Gap junction
    477625 (ADCY6)
 Organismal Systems
  Immune system
   04611 Platelet activation
    477625 (ADCY6)
   04062 Chemokine signaling pathway
    477625 (ADCY6)
  Endocrine system
   04911 Insulin secretion
    477625 (ADCY6)
   04923 Regulation of lipolysis in adipocyte
    477625 (ADCY6)
   04912 GnRH signaling pathway
    477625 (ADCY6)
   04913 Ovarian Steroidogenesis
    477625 (ADCY6)
   04915 Estrogen signaling pathway
    477625 (ADCY6)
   04914 Progesterone-mediated oocyte maturation
    477625 (ADCY6)
   04921 Oxytocin signaling pathway
    477625 (ADCY6)
   04926 Relaxin signaling pathway
    477625 (ADCY6)
   04918 Thyroid hormone synthesis
    477625 (ADCY6)
   04928 Parathyroid hormone synthesis, secretion and action
    477625 (ADCY6)
   04916 Melanogenesis
    477625 (ADCY6)
   04924 Renin secretion
    477625 (ADCY6)
   04925 Aldosterone synthesis and secretion
    477625 (ADCY6)
   04927 Cortisol synthesis and secretion
    477625 (ADCY6)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    477625 (ADCY6)
   04270 Vascular smooth muscle contraction
    477625 (ADCY6)
  Digestive system
   04970 Salivary secretion
    477625 (ADCY6)
   04971 Gastric acid secretion
    477625 (ADCY6)
   04972 Pancreatic secretion
    477625 (ADCY6)
   04976 Bile secretion
    477625 (ADCY6)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    477625 (ADCY6)
   04961 Endocrine and other factor-regulated calcium reabsorption
    477625 (ADCY6)
  Nervous system
   04724 Glutamatergic synapse
    477625 (ADCY6)
   04727 GABAergic synapse
    477625 (ADCY6)
   04725 Cholinergic synapse
    477625 (ADCY6)
   04723 Retrograde endocannabinoid signaling
    477625 (ADCY6)
  Sensory system
   04742 Taste transduction
    477625 (ADCY6)
   04750 Inflammatory mediator regulation of TRP channels
    477625 (ADCY6)
  Aging
   04211 Longevity regulating pathway - mammal
    477625 (ADCY6)
   04213 Longevity regulating pathway - multiple species
    477625 (ADCY6)
  Environmental adaptation
   04713 Circadian entrainment
    477625 (ADCY6)
   04714 Thermogenesis
    477625 (ADCY6)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    477625 (ADCY6)
  Substance dependence
   05032 Morphine addiction
    477625 (ADCY6)
  Cardiovascular diseases
   05414 Dilated cardiomyopathy (DCM)
    477625 (ADCY6)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    477625 (ADCY6)
  Infectious diseases
   05166 HTLV-I infection
    477625 (ADCY6)
  Drug resistance
   01522 Endocrine resistance
    477625 (ADCY6)
Enzymes [BR:cfa01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     477625 (ADCY6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AC_N Guanylate_cyc DUF1053 HNOBA Shisa
Motif
Other DBs
NCBI-GeneID: 477625
NCBI-ProteinID: NP_001182076
Ensembl: ENSCAFG00000008907
UniProt: F1Q3J2
Position
27
AA seq 1166 aa AA seqDB search
MSWFSGLLVPKVDERKTAWGERNGQKRPRRGTRTSGFCTPRYMSCLRDAQPPSPTPAAPP
RCPWQDEAFIRRGGPGKGTELGLRAVALGFEDTEAMSAVGAAEVAPDVTPGSRRSCWRRL
AQVFQSKQFRSAKLERLYQRYFFQMNQSSLTLLMAVLVLLTAVLLAFHAAPARPQPAYVA
LLACAATLFVALMVVCNRHSFRQDSMWVVSYVVLGILAAVQVGGALAANPRSPSVGLWCP
VFFVYITYTLLPIRMRAAVFSGLGLSTLHLILAWQLNRGDAFLWKQLGANMLLFLCTNVI
GICTHYPAEVSQRQAFQETRGYIQARLHLQHENRQQERLLLSVLPQHVAMEMKEDINTKK
EDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLR
IKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRVHC
GVLGLRKWQFDVWSNDVTLANHMEAGGRAGRIHITRATLQYLNGDYEVEPGRGGERNAYL
KEQHIETFLILGASQKRKEEKAMLAKLQRTRANSMEGLMPRWVPDRAFSRTKDSKAFRQM
GIDDSSKDNRGAQDALNPEDEVDEFLGRAIDARSIDQLRKDHVRRFLLTFQREDLEKKYS
RKVDPRFGAYVACALLVFCFICFIQLLVFPHSTVMLGIYASIFVLLLITVLTCAVYSCGS
LFPKALRRLSRSIVRSRAHSTVVGIFSVLLVFTSAIANMFTCNHTPIRTCAARMLNVTPA
DITACHLQQLNYSLGLDAPLCEGTAPTCSFPEYFVGNMLLSLLASSVFLHISSIGKLAMI
FVLGLIYLVLLLLGPPATIFDNYDLLLGVHGLASSNDTFDGLDCPAAGRVALKYMTPVIL
LVFALALYLHAQQVESTARLDFLWKLQATGEKEEMEELQAYNRRLLHNILPKDVAAHFLA
RERRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLLNEIIADFDEIISEE
RFRQLEKIKTIGSTYMAASGLNASTYDQAGRSHITALADYAMRLMEQMKHINEHSFNNFQ
MKIGLNMGPVVAGVIGARKPQYDIWGNTVNVSSRMDSTGVPDRIQVTTDLYQVLAAKGYQ
LECRGVVKVKGKGEMTTYFLNGGPPS
NT seq 3501 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggtttagtggcctcctggtccccaaagtggatgaacggaagacagcctggggt
gaacgcaatgggcagaagcgtccacgccgcgggactcggaccagtggcttctgcacgccc
cgctatatgagctgcctccgggatgcgcagccccccagtcccacccctgcggctccccct
cggtgcccctggcaggatgaggccttcatccggagaggcggcccgggcaagggcacggag
ctggggctgcgggcggtggccctgggcttcgaggacactgaggccatgtcagcggttggg
gcagctgaggtggcccctgacgtgacccccgggagtaggcgatcctgctggcgccgtctg
gcccaggtgttccagtcgaagcagttccgctcggccaagctggagcgcctgtaccagcgg
tacttctttcagatgaaccagagcagcctgacgctgctgatggcggtgctggtgctgctg
acagcggtgctgctagccttccatgctgcacctgcccgccctcagcctgcctacgtggcc
ctgctggcctgtgccgccaccctcttcgtggcgctcatggtggtgtgtaaccggcacagc
tttcgccaggactccatgtgggtggtgagctacgtggtgctgggcatcctggcagccgtt
caggttgggggtgccctggcagccaacccccgcagcccctctgtgggcctctggtgccct
gtgttttttgtctacatcacctacacgctcctacccatccgcatgcgggcagctgtcttc
agtggcctgggcctgtccaccctgcatttgatcttggcctggcaactcaaccgcggtgac
gccttcctctggaagcagctcggtgccaacatgctgctgttcctctgcaccaacgtcatt
ggcatctgcacacactacccagctgaggtctctcagcgccaggcctttcaggagacccgc
ggttacattcaggcccggctgcacctgcagcatgagaaccggcagcaggaacggctgctg
ctgtccgtgttgccccagcatgttgccatggagatgaaagaagatatcaacacaaagaaa
gaagacatgatgttccacaagatctacatccagaagcatgacaatgtcagcatcctgttt
gcagacattgaaggcttcaccagcctggcgtcccagtgcaccgcgcaggagctggtcatg
accctgaacgagctcttcgcccggtttgacaagctggctgcggaaaatcactgcctgagg
atcaagatcttaggggactgttactactgtgtgtcggggctgccggaggcccgggcagac
catgcccactgctgtgtggagatgggggtggacatgatcgaggccatctcgctggtgcgt
gaggtgacaggtgtgaacgtgaacatgcgcgtgggcatccacagcgggcgtgtgcactgt
ggcgtccttggcctgcggaaatggcagttcgacgtgtggtccaatgacgtgactctggcc
aaccatatggaggcgggcggccgggccggccgcatccacatcacccgggccacgctgcag
tacctgaacggggactacgaggtggagccgggccgcggtggcgagcggaacgcgtacctc
aaggagcagcacatcgagaccttcctcatcctgggagccagccagaaacggaaagaggag
aaggccatgctggccaagctgcagcggacgcgggccaactccatggaaggcctgatgcca
cgctgggtgcccgaccgcgccttctcccggaccaaggactccaaggctttccgccagatg
ggcattgatgattccagcaaagacaaccggggtgcccaagatgccctgaaccccgaggat
gaggtcgatgagttcctgggccgtgccatcgatgcccgcagcatcgatcagctacggaag
gaccatgtgcgccgcttcctgctcaccttccagagagaggatcttgaaaagaagtactca
aggaaggtggacccccgcttcggagcctacgtggcctgtgcgctgttggtcttctgcttc
atctgctttatccagctcctcgtcttcccacactcaaccgtgatgcttgggatctacgcc
agtatctttgtgctgttgctgatcaccgtgctgacctgtgccgtgtactcctgtggctct
ctcttccccaaggccctgcgacgtctttcccgcagcatcgtccgctctcgggcacacagc
actgtggttggcattttttcagtcttgctagtgttcacctctgccatcgccaacatgttc
acctgtaaccacacccccatccggacctgtgcagcccggatgctgaatgtaacacccgct
gacatcactgcctgccacctgcagcagctcaattactctctgggcctggatgctccgctg
tgtgagggcaccgcacccacttgcagcttccctgagtacttcgttgggaacatgctgctg
agtctcttggccagctctgtcttcctgcacatcagtagcatcgggaagttggccatgatc
tttgtcctggggctcatttatttggtgctgcttctgctgggccccccagccaccatcttt
gacaactatgacctgctgcttggtgtccatggcttggcttcttccaatgacacctttgat
gggctggactgcccagctgcggggagggtggcactgaaatacatgacccctgtgattctg
ctggtgtttgccctggcgctgtatctgcacgcccagcaggtggaatcaactgcacgtctg
gacttcctctggaaactgcaggcaacgggggagaaggaggagatggaggagctccaggcc
tacaaccgaaggctgctgcataacattctgcctaaggacgtggctgcccacttcctggcc
cgggagcgccggaacgatgagctctactaccagtcgtgtgagtgtgtggccgtcatgttt
gcctccattgccaacttttctgagttctatgtggagctggaggcaaacaatgagggtgtc
gagtgcctgcggctgctcaacgaaatcatcgccgactttgatgagatcatcagcgaggag
cggttccggcagctggagaaaatcaagacgatcggtagcacgtacatggctgcgtcgggg
ctgaacgccagcacctacgatcaggccggccgctcccacatcactgccctggccgactat
gccatgcggctcatggagcagatgaaacacatcaacgagcactccttcaacaacttccag
atgaagattgggctgaacatgggcccagttgtggcaggcgtcattggggctcggaagcca
cagtatgacatctgggggaacacggtgaatgtctctagccgtatggacagcacgggggtt
cctgaccgaatccaggtgaccacggacttgtaccaggttctagctgccaaaggctaccag
ctggagtgtcgaggggtggtcaaggtgaagggcaagggggagatgaccacctacttcctc
aatgggggcccccccagttag

DBGET integrated database retrieval system