KEGG   Canis familiaris (dog): 477625Help
Entry
477625            CDS       T01007                                 

Gene name
ADCY6
Definition
adenylate cyclase 6 (EC:4.6.1.1)
Orthology
K08046  
adenylate cyclase 6 [EC:4.6.1.1]
Organism
cfa  Canis familiaris (dog)
Pathway
Purine metabolism
Rap1 signaling pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Gap junction
Platelet activation
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
GABAergic synapse
Taste transduction
Inflammatory mediator regulation of TRP channels
Insulin secretion
GnRH signaling pathway
Ovarian steroidogenesis
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Oxytocin signaling pathway
Endocrine and other factor-regulated calcium reabsorption
Vasopressin-regulated water reabsorption
Salivary secretion
Gastric acid secretion
Pancreatic secretion
Bile secretion
Morphine addiction
HTLV-I infection
Pathways in cancer
Dilated cardiomyopathy
Module
cAMP signaling
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    477625 (ADCY6)
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    477625 (ADCY6)
   04024 cAMP signaling pathway
    477625 (ADCY6)
   04022 cGMP - PKG signaling pathway
    477625 (ADCY6)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    477625 (ADCY6)
  Cellular commiunity
   04540 Gap junction
    477625 (ADCY6)
 Organismal Systems
  Immune system
   04611 Platelet activation
    477625 (ADCY6)
   04062 Chemokine signaling pathway
    477625 (ADCY6)
  Endocrine system
   04911 Insulin secretion
    477625 (ADCY6)
   04912 GnRH signaling pathway
    477625 (ADCY6)
   04913 Ovarian Steroidogenesis
    477625 (ADCY6)
   04915 Estrogen signaling pathway
    477625 (ADCY6)
   04914 Progesterone-mediated oocyte maturation
    477625 (ADCY6)
   04921 Oxytocin signaling pathway
    477625 (ADCY6)
   04918 Thyroid hormone synthesis
    477625 (ADCY6)
   04916 Melanogenesis
    477625 (ADCY6)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    477625 (ADCY6)
   04270 Vascular smooth muscle contraction
    477625 (ADCY6)
  Digestive system
   04970 Salivary secretion
    477625 (ADCY6)
   04971 Gastric acid secretion
    477625 (ADCY6)
   04972 Pancreatic secretion
    477625 (ADCY6)
   04976 Bile secretion
    477625 (ADCY6)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    477625 (ADCY6)
   04961 Endocrine and other factor-regulated calcium reabsorption
    477625 (ADCY6)
  Nervous system
   04724 Glutamatergic synapse
    477625 (ADCY6)
   04727 GABAergic synapse
    477625 (ADCY6)
   04725 Cholinergic synapse
    477625 (ADCY6)
   04723 Retrograde endocannabinoid signaling
    477625 (ADCY6)
  Sensory system
   04742 Taste transduction
    477625 (ADCY6)
   04750 Inflammatory mediator regulation of TRP channels
    477625 (ADCY6)
  Environmental adaptation
   04713 Circadian entrainment
    477625 (ADCY6)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    477625 (ADCY6)
  Substance dependence
   05032 Morphine addiction
    477625 (ADCY6)
  Cardiovascular diseases
   05414 Dilated cardiomyopathy (DCM)
    477625 (ADCY6)
  Infectious diseases
   05166 HTLV-I infection
    477625 (ADCY6)
Enzymes [BR:cfa01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     477625 (ADCY6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
27
AA seq 1166 aa AA seqDB search
MSWFSGLLVPKVDERKTAWGERNGQKRPRRGTRTSGFCTPRYMSCLRDAQPPSPTPAAPP
RCPWQDEAFIRRGGPGKGTELGLRAVALGFEDTEAMSAVGAAEVAPDVTPGSRRSCWRRL
AQVFQSKQFRSAKLERLYQRYFFQMNQSSLTLLMAVLVLLTAVLLAFHAAPARPQPAYVA
LLACAATLFVALMVVCNRHSFRQDSMWVVSYVVLGILAAVQVGGALAANPRSPSVGLWCP
VFFVYITYTLLPIRMRAAVFSGLGLSTLHLILAWQLNRGDAFLWKQLGANMLLFLCTNVI
GICTHYPAEVSQRQAFQETRGYIQARLHLQHENRQQERLLLSVLPQHVAMEMKEDINTKK
EDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLR
IKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRVHC
GVLGLRKWQFDVWSNDVTLANHMEAGGRAGRIHITRATLQYLNGDYEVEPGRGGERNAYL
KEQHIETFLILGASQKRKEEKAMLAKLQRTRANSMEGLMPRWVPDRAFSRTKDSKAFRQM
GIDDSSKDNRGAQDALNPEDEVDEFLGRAIDARSIDQLRKDHVRRFLLTFQREDLEKKYS
RKVDPRFGAYVACALLVFCFICFIQLLVFPHSTVMLGIYASIFVLLLITVLTCAVYSCGS
LFPKALRRLSRSIVRSRAHSTVVGIFSVLLVFTSAIANMFTCNHTPIRTCAARMLNVTPA
DITACHLQQLNYSLGLDAPLCEGTAPTCSFPEYFVGNMLLSLLASSVFLHISSIGKLAMI
FVLGLIYLVLLLLGPPATIFDNYDLLLGVHGLASSNDTFDGLDCPAAGRVALKYMTPVIL
LVFALALYLHAQQVESTARLDFLWKLQATGEKEEMEELQAYNRRLLHNILPKDVAAHFLA
RERRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLLNEIIADFDEIISEE
RFRQLEKIKTIGSTYMAASGLNASTYDQAGRSHITALADYAMRLMEQMKHINEHSFNNFQ
MKIGLNMGPVVAGVIGARKPQYDIWGNTVNVSSRMDSTGVPDRIQVTTDLYQVLAAKGYQ
LECRGVVKVKGKGEMTTYFLNGGPPS
NT seq 3501 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggtttagtggcctcctggtccccaaagtggatgaacggaagacagcctggggt
gaacgcaatgggcagaagcgtccacgccgcgggactcggaccagtggcttctgcacgccc
cgctatatgagctgcctccgggatgcgcagccccccagtcccacccctgcggctccccct
cggtgcccctggcaggatgaggccttcatccggagaggcggcccgggcaagggcacggag
ctggggctgcgggcggtggccctgggcttcgaggacactgaggccatgtcagcggttggg
gcagctgaggtggcccctgacgtgacccccgggagtaggcgatcctgctggcgccgtctg
gcccaggtgttccagtcgaagcagttccgctcggccaagctggagcgcctgtaccagcgg
tacttctttcagatgaaccagagcagcctgacgctgctgatggcggtgctggtgctgctg
acagcggtgctgctagccttccatgctgcacctgcccgccctcagcctgcctacgtggcc
ctgctggcctgtgccgccaccctcttcgtggcgctcatggtggtgtgtaaccggcacagc
tttcgccaggactccatgtgggtggtgagctacgtggtgctgggcatcctggcagccgtt
caggttgggggtgccctggcagccaacccccgcagcccctctgtgggcctctggtgccct
gtgttttttgtctacatcacctacacgctcctacccatccgcatgcgggcagctgtcttc
agtggcctgggcctgtccaccctgcatttgatcttggcctggcaactcaaccgcggtgac
gccttcctctggaagcagctcggtgccaacatgctgctgttcctctgcaccaacgtcatt
ggcatctgcacacactacccagctgaggtctctcagcgccaggcctttcaggagacccgc
ggttacattcaggcccggctgcacctgcagcatgagaaccggcagcaggaacggctgctg
ctgtccgtgttgccccagcatgttgccatggagatgaaagaagatatcaacacaaagaaa
gaagacatgatgttccacaagatctacatccagaagcatgacaatgtcagcatcctgttt
gcagacattgaaggcttcaccagcctggcgtcccagtgcaccgcgcaggagctggtcatg
accctgaacgagctcttcgcccggtttgacaagctggctgcggaaaatcactgcctgagg
atcaagatcttaggggactgttactactgtgtgtcggggctgccggaggcccgggcagac
catgcccactgctgtgtggagatgggggtggacatgatcgaggccatctcgctggtgcgt
gaggtgacaggtgtgaacgtgaacatgcgcgtgggcatccacagcgggcgtgtgcactgt
ggcgtccttggcctgcggaaatggcagttcgacgtgtggtccaatgacgtgactctggcc
aaccatatggaggcgggcggccgggccggccgcatccacatcacccgggccacgctgcag
tacctgaacggggactacgaggtggagccgggccgcggtggcgagcggaacgcgtacctc
aaggagcagcacatcgagaccttcctcatcctgggagccagccagaaacggaaagaggag
aaggccatgctggccaagctgcagcggacgcgggccaactccatggaaggcctgatgcca
cgctgggtgcccgaccgcgccttctcccggaccaaggactccaaggctttccgccagatg
ggcattgatgattccagcaaagacaaccggggtgcccaagatgccctgaaccccgaggat
gaggtcgatgagttcctgggccgtgccatcgatgcccgcagcatcgatcagctacggaag
gaccatgtgcgccgcttcctgctcaccttccagagagaggatcttgaaaagaagtactca
aggaaggtggacccccgcttcggagcctacgtggcctgtgcgctgttggtcttctgcttc
atctgctttatccagctcctcgtcttcccacactcaaccgtgatgcttgggatctacgcc
agtatctttgtgctgttgctgatcaccgtgctgacctgtgccgtgtactcctgtggctct
ctcttccccaaggccctgcgacgtctttcccgcagcatcgtccgctctcgggcacacagc
actgtggttggcattttttcagtcttgctagtgttcacctctgccatcgccaacatgttc
acctgtaaccacacccccatccggacctgtgcagcccggatgctgaatgtaacacccgct
gacatcactgcctgccacctgcagcagctcaattactctctgggcctggatgctccgctg
tgtgagggcaccgcacccacttgcagcttccctgagtacttcgttgggaacatgctgctg
agtctcttggccagctctgtcttcctgcacatcagtagcatcgggaagttggccatgatc
tttgtcctggggctcatttatttggtgctgcttctgctgggccccccagccaccatcttt
gacaactatgacctgctgcttggtgtccatggcttggcttcttccaatgacacctttgat
gggctggactgcccagctgcggggagggtggcactgaaatacatgacccctgtgattctg
ctggtgtttgccctggcgctgtatctgcacgcccagcaggtggaatcaactgcacgtctg
gacttcctctggaaactgcaggcaacgggggagaaggaggagatggaggagctccaggcc
tacaaccgaaggctgctgcataacattctgcctaaggacgtggctgcccacttcctggcc
cgggagcgccggaacgatgagctctactaccagtcgtgtgagtgtgtggccgtcatgttt
gcctccattgccaacttttctgagttctatgtggagctggaggcaaacaatgagggtgtc
gagtgcctgcggctgctcaacgaaatcatcgccgactttgatgagatcatcagcgaggag
cggttccggcagctggagaaaatcaagacgatcggtagcacgtacatggctgcgtcgggg
ctgaacgccagcacctacgatcaggccggccgctcccacatcactgccctggccgactat
gccatgcggctcatggagcagatgaaacacatcaacgagcactccttcaacaacttccag
atgaagattgggctgaacatgggcccagttgtggcaggcgtcattggggctcggaagcca
cagtatgacatctgggggaacacggtgaatgtctctagccgtatggacagcacgggggtt
cctgaccgaatccaggtgaccacggacttgtaccaggttctagctgccaaaggctaccag
ctggagtgtcgaggggtggtcaaggtgaagggcaagggggagatgaccacctacttcctc
aatgggggcccccccagttag

DBGET integrated database retrieval system