KEGG   Canis familiaris (dog): 477711Help
Entry
477711            CDS       T01007                                 

Gene name
TPI1, TIM
Definition
triosephosphate isomerase 1 (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cfa  Canis familiaris (dog)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    477711 (TPI1)
   01230 Biosynthesis of amino acids
    477711 (TPI1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    477711 (TPI1)
   00051 Fructose and mannose metabolism
    477711 (TPI1)
   00562 Inositol phosphate metabolism
    477711 (TPI1)
Enzymes [BR:cfa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     477711 (TPI1)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   477711 (TPI1)
  Exosomal proteins of bladder cancer cells
   477711 (TPI1)
  Exosomal proteins of melanoma cells
   477711 (TPI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
27
AA seq 249 aa AA seqDB search
MAPSRKFFVGGNWKMNGRKKNLGELITTLNAAKVPADTEVVCAPPTAYIDFARQKLDAKI
AVAAQNCYKVTNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDELIGQKVAHALAE
GLGVIACIGEKLDEREAGITEKVVFEQTKVIADNVKDWSKVVLAYEPVWAIGTGKTATPQ
QAQEVHEKLRGWLKSNVSDAVAQSTRIIYGGSVTGATCKELASQPDVDGFLVGGASLKPE
FVDIINAKQ
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggcgccctccaggaagttcttcgtcggggggaactggaagatgaacgggcgcaagaag
aacctgggggagctcatcaccaccctgaacgcggccaaggtgccggccgacaccgaagtg
gtttgtgcacctcccactgcctacatcgacttcgctcggcagaagctagatgccaagatt
gctgtggctgcacagaactgctacaaagtgactaacggggcctttactggggagatcagc
cctggcatgatcaaagactgcggagccacatgggtagtcctggggcactcggaaagaagg
catgtctttggggagtcggatgagctgattggacagaaagtggcccacgccctggcagag
ggactcggagtaattgcctgcattggggagaagctagatgagagggaagctggcatcact
gagaaggttgttttcgagcaaaccaaggtcatcgcagataacgtgaaggactggagcaag
gttgtcctggcctatgagcctgtatgggccattgggactggcaagactgcaacaccccaa
caggcccaggaagtacatgaaaagctccggggatggctcaagtccaacgtctctgatgca
gtggctcagagcacccgtatcatttacggaggttctgtgactggagcaacctgcaaagag
ctggcaagccagcctgatgtggatggcttcctcgtgggtggggcttccctcaagcctgag
tttgtggatatcatcaacgccaaacaataa

DBGET integrated database retrieval system