KEGG   Canis familiaris (dog): 477720Help
Entry
477720            CDS       T01007                                 

Gene name
DYRK4
Definition
(RefSeq) dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 4
  KO
K18669  
dual specificity tyrosine-phosphorylation-regulated kinase 2/3/4 [EC:2.7.12.1]
Organism
cfa  Canis familiaris (dog)
Brite
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     477720 (DYRK4)
Protein kinases [BR:cfa01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   477720 (DYRK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
27
AA seq 639 aa AA seqDB search
MGMAARGREVFFRPTRERTKMDAKKPRKCSLTSFPSLKAKKKQNLSPGKVESKPLAQAQK
PPSKIKNLRMTRFLHKNPNTSITSLPFVDTKGKKNMVNFPCIGNKILLKPPLLYQDNQSH
NQLPASELKASELPFHSSIKTKDPKPEEKPPRKHKVPLTAAEALKCFKNQLSSYEQSEVL
GYTELWFLGLEAEKLHMTPEKFNKMSFDDEHGSYMKVLHDHIAYRYEVLEMIGKGSFGQV
AKCLDHKNNELVALKIIRNKKRFHHQALVELKILEALRRKDKDNTYNVVHMKDFFYFRNH
LCITFELLGINLYELMKNNSFQGFSLSIVRRFTLSVLKCLQMLYVEKIIHCDLKPENIVL
YQKGQVSVKVIDFGSSCYEHQKVYTYIQSRFYRSPEVILGHPYNMAIDMWSLGCIMAELY
TGYPLFPGENEMEQLACIMEVLGLPPTHFIQTASRRQTFFDSKGFPKNMTNNRGKKRYPD
SKDLTMVLKTYDTSFLDFLRRCLVWEPSLRMTPDQALKHAWIHEPRNLKPRYRPQTLRKP
SLCLPSEAQKDKVQGHHRLGIKEVIIKEETSSVTAKQVQNSGDQWSSLQHAAEVVQLPQL
TETSRKPEAVVGPEESKTSPGKQSKNSSPKNMNILPPIV
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgggaatggcggcgaggggaagagaggtgttcttccggccgacacgtgaaaggactaaa
atggatgctaaaaagccaaggaaatgcagtttgacatccttcccaagtttgaaagcaaaa
aagaaacagaatctcagccctggaaaggttgagagtaagcctttggctcaagcccagaag
ccaccttccaagattaagaacctcagaatgactcgattcttacataagaatccaaacacc
agcattacttcactcccttttgtggataccaaggggaagaaaaacatggttaactttcca
tgcatcggcaacaaaatcttgctaaagccacccctgctgtatcaggataatcaaagtcat
aatcagttgccagcctctgaactcaaggcttctgaattgcctttccattcaagcattaaa
accaaagatcccaagccagaggagaaaccaccaagaaagcacaaggtgcctctcactgca
gcagaggccttaaagtgttttaagaaccagctatcttcgtatgagcaaagtgaagtcctg
ggctacacagagctgtggttcctggggcttgaagcagagaagctccacatgactcctgag
aagttcaacaaaatgagtttcgatgatgaacatggctcctatatgaaggtcctgcatgac
cacattgcctatcgctatgaggttttggagatgatcgggaaagggtcctttggacaggtg
gccaagtgcttggatcacaaaaacaatgagttggtggccttgaaaatcatcaggaacaag
aagagatttcaccaccaagccctggtggaattgaagatcctggaagctctcagaaggaag
gacaaagacaacacctacaatgtggtacacatgaaggacttcttctattttcgcaatcat
ctctgcatcacctttgaactcctgggaatcaacttgtatgagttgatgaagaataatagc
tttcaaggcttcagtctgtcaatagttcgacgcttcaccctctctgttttgaagtgtttg
caaatgctttatgtagagaaaatcattcactgtgatctcaagcccgagaatatagtgtta
tatcaaaagggccaagtttctgttaaagtcattgactttggatcaagctgttatgaacac
cagaaagtatacacttacatccaaagccggttctatagatccccagaggtgattctgggc
catccctacaacatggccattgatatgtggagcctgggctgcatcatggctgagttgtac
acaggctaccctctgttccccggggagaatgaaatggagcagctggcttgcatcatggag
gtgctgggcctgccaccaacccacttcattcagacggcctccaggagacagacattcttt
gattccaaaggttttcctaaaaatatgaccaacaacagggggaaaaaaagatacccggat
tccaaggatctcacgatggtgctgaaaacctatgacaccagcttcctggactttctcaga
aggtgtttggtatgggaaccttctcttcgcatgacccctgaccaggctctcaagcatgct
tggattcatgagccacggaatctcaaaccacggtacaggccccagaccctgaggaaaccc
agtctctgtctcccctctgaggctcagaaggacaaggttcaagggcatcatcgcttaggc
ataaaagaggtgatcatcaaagaagagacaagcagtgtcactgctaagcaggttcagaat
tcgggtgatcagtggagctctctgcagcatgcagctgaagttgtccagctgcctcaacta
acagaaacttccagaaagccagaggcagttgttggaccagaggagtccaagacctcccca
ggaaaacaaagtaaaaactcctcacccaagaacatgaatattttaccacctattgtatga

DBGET integrated database retrieval system