KEGG   Canis familiaris (dog): 478019Help
Entry
478019            CDS       T01007                                 

Gene name
PFKP
Definition
(RefSeq) phosphofructokinase, platelet
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cfa  Canis familiaris (dog)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
AMPK signaling pathway
Central carbon metabolism in cancer
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    478019 (PFKP)
   01230 Biosynthesis of amino acids
    478019 (PFKP)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    478019 (PFKP)
   00030 Pentose phosphate pathway
    478019 (PFKP)
   00051 Fructose and mannose metabolism
    478019 (PFKP)
   00052 Galactose metabolism
    478019 (PFKP)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    478019 (PFKP)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    478019 (PFKP)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    478019 (PFKP)
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     478019 (PFKP)
Protein phosphatases and associated proteins [BR:cfa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     478019 (PFKP)
Messenger RNA biogenesis [BR:cfa03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     478019 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 803 aa AA seqDB search
MNAAVRAVVRMGIYVGAKVYFIYEGYQGMVDGGSNIVEADWESVSSILQVGGTIIGSARC
KAFRTREGRLKAACNLVQRGITNLCVIGGDGSLTGANIFRKEWSGLLEELAQHGEIDKEQ
VQKHAYLNVVGMVGSIDNDFCGTDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMG
RHCGYLALVSALACGADWVFLPESPPEEGWQENMCIKLSENRARKKRLNIIIVAEGAIDT
QNKPITSEQIKELVVTQLGYDTRVTILGHVQRGGTPSAFDRILASRMGVEAVVALLQATP
ETPPCVVSLSGTQAVRLPLVECVQMTQDVQKAMDERRFKDAVRLRGRSFETNLNTYKRLA
IKFPDDQIVKSNCNVAVINVGAPAAGMNAAVRSAVRVGIADGHKMLAIYDGFEGFAKGQV
KEIGWGDVGGWTGQGGSILGTKRTLPGKFLEDIAQQMRTHSINALLIIGGFEAYLGLLEL
SAARDKYEEFCVPMVMVPATVSNNVPGSDFSIGADTALNTITDAFESSLLLAKAREQHRE
FCVPVCVLPTTISNSVPGTELSLGCDTSLNAVMETCDRIKQSASGTKRRVFIIETMGGYC
GYLANMGALAAGADAAYIFEEPFDIRDLQSNVEHLTEKMKTTIQRGLVLRNESCSENYTT
DFIYQLYSEEGKGVFDCRKNVLGHMQQGGAPSPFDRNFGTKISARAMQWISMKLKESPGK
GKRFVTDDSICVLGISKRNLFFQPVTELKKETDFEHRIPKEQWWLKLRPLMKILAKYEAS
YEVSDSGQLEHVHHRGHEEPAAI
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctgccgtccgagctgtcgtgcgcatgggcatatacgtgggagccaaagtgtac
ttcatctatgagggttaccagggcatggtcgacggcggcagcaacatcgtggaggccgac
tgggaaagcgtctcgagcatcctgcaagtgggagggaccattatcggcagtgcccgttgc
aaagccttccggacgcgggagggtcgcctgaaagccgcgtgtaacttggttcagcggggc
atcaccaacctgtgcgtgatcggcggggacgggagcctcacgggagccaacatcttccgg
aaggagtggagcgggctgctggaggagctggcccaacacggtgagatcgacaaggagcag
gtgcagaagcacgcgtacctcaacgtcgtgggcatggtgggctccatcgacaacgacttc
tgcgggacggacatgaccatcggcaccgactctgccttgcacaggatcatcgaggtcgtt
gacgccatcatgaccaccgcccagagccaccagaggacctttgttctcgaggttatgggg
agacactgcgggtacctcgccctggtgagcgccttggcctgtggcgccgactgggtgttc
cttccggaatcgccgccagaagagggttggcaggagaatatgtgcatcaagctctcagag
aaccgtgcccggaaaaagagactgaatatcatcatcgtggccgagggcgccatagacacc
cagaataagcctatcacctccgagcagatcaaggagctcgtggtcacacagctgggatat
gacacgcgggtgaccatacttgggcacgtgcagagaggagggactccctcggccttcgac
cggattttggccagtcgcatgggggtggaggccgtggttgccctcctccaggccaccccg
gagacgccgccctgcgtggtgtcgctgagcgggacccaggcggtgcgcctgcccctggtg
gagtgtgtgcagatgacccaggacgtgcagaaggccatggacgagaggagattcaaggat
gccgtgcggctccgcggcaggagtttcgagaccaacctcaacacctacaagcggcttgcc
atcaagttcccagatgatcagattgtgaagagcaactgtaacgtggccgtcataaacgtg
ggggcgcccgccgccgggatgaacgccgccgtgcgctcggccgtgcgggtgggcatcgcc
gatggccacaagatgctcgccatctacgacggctttgagggcttcgccaaaggccaggtg
aaggaaatcggctggggggatgtcggaggctggaccggccaaggaggctccatcctcggg
accaaacgcacgctgcccgggaagtttctggaggacatcgcccagcagatgcgcacccac
agcatcaatgcgctgctcatcatcggcgggttcgaggcctacttgggcctgctggagctg
tcagccgcccgcgacaagtacgaggagttctgtgtccccatggtaatggtcccagccact
gtctccaacaacgtgcctggctccgatttcagcatcggcgcggacaccgccctgaacacc
atcaccgacgctttcgagagctcgctcctgctggccaaggcgcgcgagcagcaccgggag
ttttgcgtgcccgtgtgcgtcctgcccaccaccataagcaacagcgtcccgggcacagag
ctgagcctgggctgtgatactagcctcaatgccgtgatggagacgtgcgaccgcatcaaa
cagtcggccagcgggaccaagcggcgcgtgttcatcatcgagaccatggggggctactgc
ggctacctggccaacatgggggcgctcgccgcgggagccgatgccgcctacatctttgag
gagccgtttgacatccgagatctgcagtccaacgtggagcacctgacggagaaaatgaag
accaccattcagagggggctcgtgctcaggaacgagagctgcagtgagaactacaccaca
gacttcatctaccagctgtactccgaggagggcaagggcgtgttcgactgcaggaagaac
gtgctgggccacatgcagcagggtggagcgccctcaccattcgatagaaacttcggaacc
aaaatctccgccagagccatgcagtggatcagcatgaaattgaaggagtctccgggcaaa
ggaaaaagatttgtgaccgatgattccatctgcgtgctgggaataagcaaaagaaatctt
ttcttccaaccggtgacagagctgaagaaggaaaccgacttcgagcacaggatccccaaa
gagcagtggtggctgaagctgcggccgctaatgaagatcctggccaagtacgaggctagc
tacgaggtctccgactccggccagctggagcatgtgcaccaccgaggccacgaggagccc
gccgccatctag

DBGET integrated database retrieval system