KEGG   Canis familiaris (dog): 478040Help
Entry
478040            CDS       T01007                                 

Gene name
HDAC3
Definition
histone deacetylase 3
Orthology
K11404  
histone deacetylase 3 [EC:3.5.1.98]
Organism
cfa  Canis familiaris (dog)
Pathway
Thyroid hormone signaling pathway
Alcoholism
Viral carcinogenesis
Class
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:cfa04919]
Human Diseases; Cancers; Viral carcinogenesis [PATH:cfa05203]
Human Diseases; Substance dependence; Alcoholism [PATH:cfa05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 428 aa AA seqDB search
MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCR
FHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNN
KICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEA
FYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVI
NQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTV
RNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQ
TIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDN
DKESDVEI
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggccaagactgtggcctatttctacgaccccgatgtggggaacttccactacggggca
gggcaccctatgaagccccatcgcttggcattgacccacagtctggtcctgcactacggt
ctctataagaaaatgatcgtcttcaagccataccaggcctcccagcatgacatgtgccgc
tttcattctgaggactacatcgacttcttgcagagagtcagccccaccaatatgcaaggc
ttcaccaagagccttaatgccttcaacgtgggcgatgactgcccagtgtttcccgggctc
ttcgagttctgttctcgttacacaggcgcatctctgcaaggagcaacccagctgaacaac
aagatctgtgatattgccattaactgggctggtggtctccaccatgccaagaagtttgag
gcctctggcttctgctatgtcaatgacattgtgattggcatcttggagctgctcaagtac
caccctcgggtgctctacattgatattgacatccaccatggtgatggagttcaggaagcg
ttctacctcactgaccgggtcatgacagtttctttccacaaatacggaaactacttcttt
cctggcacaggtgatatgtatgaagttggagcagagagtggccgttactactgtctcaat
gtgcccttgcgggatggcattgatgaccagagttacaagcaccttttccagccagttatc
aaccaggtggtggacttctaccaacccacgtgcattgtgctccagtgtggagcggactct
ctgggctgtgaccgtttgggctgcttcaacctcagcattcgaggacatggagaatgtgtc
gaatatgtcaagagcttcaatatccctctactggtgctaggtggtggtggctatactgtc
cgaaatgttgcccgctgctggacatatgaaacatcactgctggtagaagaggccattagt
gaggagcttccctatagtgaatacttcgagtactttgccccagacttcacgctccatcca
gatgtcagcacccgcatcgagaatcagaactcacgccagtatttggaccagatccgccag
acaatctttgaaaacctgaagatgctgaaccatgcacccagtgtccagattcatgatgtg
cctgcggacctcctgacctatgacaggactgatgaggctgatgcagaggagagaggtcct
gaagagaattacagcaggccagaggcacccaacgagttctatgatggagaccatgacaac
gataaggaaagtgacgtggagatttaa

DBGET integrated database retrieval system