KEGG   Canis familiaris (dog): 478040Help
Entry
478040            CDS       T01007                                 

Gene name
HDAC3
Definition
(RefSeq) histone deacetylase 3
  KO
K11404  
histone deacetylase 3 [EC:3.5.1.98]
Organism
cfa  Canis familiaris (dog)
Pathway
Thyroid hormone signaling pathway
Alcoholism
Human papillomavirus infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    478040 (HDAC3)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    478040 (HDAC3)
  Substance dependence
   05034 Alcoholism
    478040 (HDAC3)
  Infectious diseases
   05165 Human papillomavirus infection
    478040 (HDAC3)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     478040 (HDAC3)
Chromosome [BR:cfa03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     478040 (HDAC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
2
AA seq 414 aa AA seqDB search
MPRSGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVS
PTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLH
HAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHK
YGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVL
QCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLL
VEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPS
VQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgcctcggtcgggggcagggcaccctatgaagccccatcgcttggcattgacccacagt
ctggtcctgcactacggtctctataagaaaatgatcgtcttcaagccataccaggcctcc
cagcatgacatgtgccgctttcattctgaggactacatcgacttcttgcagagagtcagc
cccaccaatatgcaaggcttcaccaagagccttaatgccttcaacgtgggcgatgactgc
ccagtgtttcccgggctcttcgagttctgttctcgttacacaggcgcatctctgcaagga
gcaacccagctgaacaacaagatctgtgatattgccattaactgggctggtggtctccac
catgccaagaagtttgaggcctctggcttctgctatgtcaatgacattgtgattggcatc
ttggagctgctcaagtaccaccctcgggtgctctacattgatattgacatccaccatggt
gatggagttcaggaagcgttctacctcactgaccgggtcatgacagtttctttccacaaa
tacggaaactacttctttcctggcacaggtgatatgtatgaagttggagcagagagtggc
cgttactactgtctcaatgtgcccttgcgggatggcattgatgaccagagttacaagcac
cttttccagccagttatcaaccaggtggtggacttctaccaacccacgtgcattgtgctc
cagtgtggagcggactctctgggctgtgaccgtttgggctgcttcaacctcagcattcga
ggacatggagaatgtgtcgaatatgtcaagagcttcaatatccctctactggtgctaggt
ggtggtggctatactgtccgaaatgttgcccgctgctggacatatgaaacatcactgctg
gtagaagaggccattagtgaggagcttccctatagtgaatacttcgagtactttgcccca
gacttcacgctccatccagatgtcagcacccgcatcgagaatcagaactcacgccagtat
ttggaccagatccgccagacaatctttgaaaacctgaagatgctgaaccatgcacccagt
gtccagattcatgatgtgcctgcggacctcctgacctatgacaggactgatgaggctgat
gcagaggagagaggtcctgaagagaattacagcaggccagaggcacccaacgagttctat
gatggagaccatgacaacgataaggaaagtgacgtggagatttaa

DBGET integrated database retrieval system