KEGG   Canis familiaris (dog): 478100Help
Entry
478100            CDS       T01007                                 

Gene name
HEXB
Definition
hexosaminidase B (beta polypeptide)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
cfa  Canis familiaris (dog)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Module
Keratan sulfate degradation
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    478100 (HEXB)
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    478100 (HEXB)
   00603 Glycosphingolipid biosynthesis - globo series
    478100 (HEXB)
   00604 Glycosphingolipid biosynthesis - ganglio series
    478100 (HEXB)
   00511 Other glycan degradation
    478100 (HEXB)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    478100 (HEXB)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     478100 (HEXB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 564 aa AA seqDB search
MLRKCHLQDEAMERCRSFLFALVLFWITWSGGGQQHNKPMERLTWQCGCHQSRCHILKSG
ALVAHLVWETSAPSTPDGPPPAGDHRLRDSETVWTALFSESSPRKSNVQLEYHGYIFNLD
KSQRGPAKRNSAVELKQLLVSIVLDSECDLYPNVTSDESYSLVVKAPVAFLKANRVWGAL
RGLETFSQLIYQDSYGTFTINECNIIDSPRFPHRGILIDTARHFLPIKSILETLDAMAFN
KFNVLHWHIVDDQSFPYQSVTFPELSNKGSYSLSHVYTPTDVHTVIEYARLRGIRVIPEF
DSPGHTQSWGKGQKNLLTPCYNGHKQSETFGPINPILNSTYSFLSQLFKEVSAVFPDQFI
HLGGDEVEFKCWESNPEIRDFMKWKGFGEDYKKLESFYVQKVLDIASTVNKGAIVWQEVF
DDHVKLQPGTIVQVWKFQSYSEEQAQVTAAGFPVILSAPWYLDWISYGQDWKGYYKVDPL
DFSGSPEQKKLVMGGEACLWGEYVDATNLTPRLWPRASAIGERLWSHSDVKDLEDAYNRL
TVHRCRMVSRGIAAEPLYTGYCNH
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgttgcggaagtgtcacctacaagacgaagccatggaaaggtgtcgtagcttcctcttt
gctcttgttctcttttggatcacttggtctgggggaggccagcagcacaataaacccatg
gagagactcacgtggcaatgtggctgccaccagtccaggtgtcacatactgaagagtggg
gctcttgtggctcacttggtgtgggaaacctctgcccccagcacccctgatggcccacct
cctgctggtgatcatcggcttagagattccgagacggtctggacagccctattttcagaa
agctcccccagaaaatccaatgtgcagttggaataccatggctatatttttaatttggac
aagtcacagcgtggccctgctaaacgtaacagtgcggtggagttaaagcaacttctcgtc
tccattgtccttgactcggagtgtgatctttaccccaacgtcacttcagatgagtcctat
agtttggttgtgaaagcaccggtggctttcctcaaggccaacagagtgtggggagcattg
cgaggtttagagacctttagccagttaatttatcaagattcttatgggacttttaccatc
aacgagtgcaacattattgattctccaaggtttccgcacagaggaattttaattgataca
gctagacatttcctgcccattaagagtattcttgaaaccctggatgccatggcttttaat
aagtttaatgttctccactggcacatagtcgatgaccagtctttcccttatcagagtgtc
acttttcctgagttaagcaacaaaggaagctattctttgtctcacgtttatacaccaact
gacgtccatacagtaattgaatatgcccgattacgagggattcgagtcataccagaattt
gacagccctggacatacacagtcttggggaaaaggtcagaaaaacctcctgactccatgt
tacaatggacataagcagtctgagacctttggacccataaaccctattctgaattcaact
tactccttcctgtctcagcttttcaaagaagttagtgcagtgtttccagatcagttcatt
cacttgggaggagacgaagtggaatttaaatgttgggagtccaatccagaaatcagagat
ttcatgaagtggaagggctttggtgaagattataaaaaactagaatctttctatgttcag
aaggttttggatattgcttcaactgtaaacaagggagccatagtctggcaagaagttttt
gatgatcatgtgaagcttcagccaggcacgattgttcaagtatggaaatttcaatcgtat
agtgaggaacaagctcaagtcacagccgctggcttccctgtcatcctttctgctccttgg
tacttagattggattagttatggacaagactggaaaggttactataaagtggaccctctt
gattttagtggttctccagaacagaaaaaacttgtcatgggtggagaagcttgtctgtgg
ggagaatatgtggatgcaactaacctcactccaagattatggccccgggcaagtgctatt
ggtgagagactgtggagtcacagcgacgtcaaagacctagaggatgcctacaacagactg
acagttcaccgctgcagaatggtcagccggggaatagctgcagaacctctttatactgga
tattgtaaccactga

DBGET integrated database retrieval system