KEGG   Canis familiaris (dog): 478198Help
Entry
478198            CDS       T01007                                 

Gene name
USP48
Definition
ubiquitin specific peptidase 48
Orthology
K11858  
ubiquitin carboxyl-terminal hydrolase 48 [EC:3.4.19.12]
Organism
cfa  Canis familiaris (dog)
Brite
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     478198 (USP48)
Peptidases [BR:cfa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   478198 (USP48)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2
AA seq 1055 aa AA seqDB search
MAPRLQLEKAAWRWAETVRPEEVSQEHIETAYRIWLEPCIRGVCRRNCKGNPNCLVGIGE
HIWLGEIDENSFHNIDDPNCERRKKNSFVGLTNLGATCYVNTFLQVWFLNLELRQALYLC
PSTCSDYMMGDGIQEEKDYEPQTICEHLQYLFALLQNSNRRYIDPSGFVKALGLDTGQQQ
DAQEFSKLFMSLLEDTLSKQKNPDVRNIVQQQFCGEYAYVTVCNQCGRESKLLSKFYELE
LNIQGHKQLTDCISEFLKEEKLEGDNRYFCENCQSKQNATRKIRLLSLPCTLNLQLMRFV
FDRQTGHKKKLNTYIGFSEILDMEPYVEHKGGSYVYELSAVLIHRGVSAYSGHYIAHVKD
PQSGEWYKFNDEDIEKMEGKKLQLGIEEDLAEPSKSQTRKPKCGKGTHCSRNAYMLVYRL
QTQEKPNTTVQVPAFLQELVDRDNSKFEEWCIEMAEMRKQSVDKGKAKHEEVKELYQRLP
AGAEPYEFVSLEWLQKWLDESTPTKPIDNHACLCSHDKLHPDKISIMKRISEYAADIFYS
RYGGGPRLTVKALCKECVVERCRVLRLKSQLNEDYKTVNNLLKATVKGNDGFWVGKSSLR
SWRQLALEQLDEQDGDVDQSNGKMNGNTLSKDESKEERKEEEEELNFNEDILCPHGELCI
SENERRLVSKEAWSKLQQYFPKAPEFPSYRECCSQCKILEREGEENEALHKMIANEQKTS
LPNLFQDKNRPCLSNWPEETDVLYIVSQFFVEEWRKFVRKPTRCSPVSSVGNSALLCPHG
GLMFTFASMTKEDSKLIALIWPSEWQMIQKLFVVDHVIKIIRTEVGDVNPSETQYISEPK
LCPECREGLLCQQQRDLREYTQATIYVHKVVDNKKVMKDSAPELNVSSSETEEDKEEAKP
DGEKDPDFNQSNGGTKRQKITHQNYIAYQKQVIRRSMRHRKVRGEKALLVSANQTLKELK
IQIMHAFSVAPFDQNLSIDGKILSDDCATLGTLGVIPESVILLKADEPIADYAAMDDVMQ
VCMPEEGFKALLSTRYYYKETPDVVKTKTKQKISL
NT seq 3168 nt NT seq  +upstreamnt  +downstreamnt
atggccccacggctgcagctggagaaggcggcctggcgctgggcggagacggtgcggccc
gaggaggtgtcgcaggagcacatcgagaccgcctaccgcatctggctggagccctgcatc
cgcggcgtgtgcagacgaaactgcaaaggaaatccgaattgcttggtagggattggtgag
catatttggttaggagaaatagatgagaatagttttcataacattgatgatcccaactgt
gagaggagaaaaaagaactcatttgtgggcctcactaaccttggcgctacttgttatgtc
aacacatttcttcaagtgtggttcctcaatttggagcttcggcaggcactatacttatgt
ccaagtacctgtagcgactacatgatgggagatggtatccaggaagagaaagattatgag
cctcagacaatttgtgagcatctccagtacttgtttgccttgttgcaaaacagtaatagg
cggtacattgatccatcaggatttgttaaagccttgggcttggacacagggcaacagcag
gatgcccaagaattttcaaagctgtttatgtctttgttggaagatactttgtctaaacaa
aaaaatccagatgtgcggaacattgtccaacagcagttctgtggagaatatgcttacgta
accgtttgcaatcaatgtggcagagagtctaagcttttatcaaagttttatgaactggag
ttaaatatccaaggccacaagcaattaacagattgcatctcagaatttttgaaggaagaa
aaattagaaggagacaatcgatacttttgtgaaaactgtcaaagtaaacagaatgcaaca
aggaagatcagactccttagccttccctgtaccttgaacttacagctgatgcgttttgtc
tttgacaggcaaactggacataagaaaaaactgaatacgtacatcggcttctcagaaatt
ttggatatggagccttatgtggaacataaaggtgggtcctatgtgtatgaactcagtgca
gtcctcatacacagaggagtgagtgcttattctggccactacattgcccatgtgaaagat
ccacagtccggtgaatggtataagtttaatgacgaagacatagaaaagatggaagggaag
aaattacaactagggattgaggaagatctagcagagccttctaagtcccagacacgtaaa
cccaagtgtggcaaaggaactcattgctctcgaaatgcgtacatgttggtgtatagatta
caaactcaagaaaaacctaacacaactgttcaggtaccagcctttcttcaagagctggta
gatcgggataattccaagtttgaagagtggtgtattgaaatggccgagatgcgcaagcaa
agtgtggacaaaggaaaagcaaaacatgaagaggttaaggagctgtaccaaaggttacct
gctggagctgagccctatgagtttgtgtctctggagtggctacaaaagtggttggatgaa
tcgacacccaccaagcctatcgataatcatgcctgcctgtgttcccatgacaagcttcat
cctgacaagatctcaattatgaagagaatatctgaatatgcagcagacattttctacagt
cgttatgggggaggaccaagacttactgtgaaagccctgtgtaaggagtgtgtggtagag
cgctgtcgtgtgttgcgtctcaagagccaactaaatgaagattataaaactgttaataat
ctactaaaagcaacagtaaagggcaatgatggattttgggtggggaaatcctccctgcgc
agttggcgccagctcgctcttgaacagttagatgaacaagatggtgatgtagaccaaagc
aacgggaaaatgaacggcaacacattgagtaaagatgaatcaaaagaagaaaggaaagaa
gaggaggaggaattaaattttaatgaagacattctttgtccacatggggagttatgcata
tctgaaaatgaaagaagacttgtttctaaagaggcttggagcaaactgcagcagtatttt
ccaaaggctcccgagtttccaagttacagagaatgctgttcacagtgcaagattttagaa
agagaaggggaagaaaatgaagccttacataagatgattgcaaatgagcaaaagacttct
cttccaaatctgtttcaggacaagaacagaccctgtctcagtaactggccagaggaaacg
gatgtcctctacattgtgtcacaattcttcgtagaagaatggcgtaaatttgttagaaaa
cctacaagatgtagtccagtgtcatcggttggaaacagtgctcttctgtgcccccatggg
ggactcatgtttacatttgcttccatgaccaaagaagattctaaacttatagctctcata
tggcccagtgagtggcagatgatacaaaagctctttgtcgtggatcatgtaattaaaatc
ataagaactgaagtgggagatgtaaacccttcagaaacacagtatatttctgaaccaaaa
ctctgtccagaatgcagagagggcttattgtgtcaacagcagagggacctacgtgaatat
actcaagccaccatctatgtccataaagttgtggataacaaaaaggtgatgaaggattca
gctccagagctgaatgtgagtagttccgaaacagaggaggataaggaagaagctaaacca
gatggagaaaaagatccagattttaatcaaagcaatggaggaacaaagcgacaaaagatc
acccatcaaaattatatagcctatcaaaagcaagttattcggcgcagtatgcgacataga
aaagttcgtggtgagaaagcacttcttgtttctgctaatcaaacgttaaaagaattgaaa
attcagatcatgcatgccttttcagttgctccttttgaccagaatctgtcaattgatgga
aagattttaagtgatgactgtgccactctcggaacccttggtgtcattcctgaatctgtc
attttgttaaaggctgatgagccaattgcggattatgccgcaatggatgacgtcatgcaa
gtatgtatgccggaagaagggtttaaagctttgttgtctacacgttactactacaaagaa
actcctgatgtggttaaaacaaaaacaaagcaaaaaatttctttatga

DBGET integrated database retrieval system