KEGG   Canis familiaris (dog): 478216Help
Entry
478216            CDS       T01007                                 

Gene name
PADI3
Definition
peptidyl arginine deiminase, type III
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
cfa  Canis familiaris (dog)
Brite
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     478216 (PADI3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2
AA seq 664 aa AA seqDB search
MSPQRIVRVSLEHPTSAVCVAGVETLVDIYGSVPEGTEMFEVYGTPGVDVYISPSMERGR
ERADTRRWHFDNGLEIIVVMNSPSNDLNDSHVQISYHSSHEPLPLAYAVLYLTCVDIALD
CDLNCEGRQDRSYVDKRQWVWGPGGYGAVLLVNCDRDDVTCYDQDNCDRHVNCLQDLEDM
SVMVLRTQGPAALFDDHKLILHTSSYDAKWARVFHACGPEDSCEAYRHVLGQNKVSYEVP
RFHGDEERFFVEGLSFPDARFTGLVSFHVTLLDDSNEDFSESPIFTDTVVFRVAPWIMTP
STLPPLEVYVCRVRNNTCFVDAVAELARKAGCKLTVCPQKENRNDRWIQDEMELGYVQAP
HKTFPVVFDSPRNGELQDFPYKRILGPDFGYVTREPQDSSVSGLDSFGNLEVSPPVVADG
KEYPLGRILIGGNLPGSSGRRVTQVVRDFLYAQRVQPPVELFVDWLAVGHVDEFLSFVPA
PDGKGFRMLLASPSACFKLFQEKQKWGHGRALLFKGVVGDKPVHTVSINQVLSNVDLISY
NKFVQSCIDWNREVLKRELGLTERDIVDIPQLFKTERKKAVAFFPDLVNMLVLGKHLGIP
KPFGPIINGQCCLEEKVRSLLEPLGLHCTFIDDFTPYHMLHGEVHCGTNVRRQPFSFKWW
NMVP
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgtccccgcagaggatcgtgcgtgtgtccctggagcatcccaccagcgccgtgtgtgtg
gctggcgtggagaccctcgtggacatttacgggtcggtacctgagggcacggagatgttc
gaggtgtatgggacccccggtgtggacgtctacatctctcctagtatggagaggggccgg
gagcgtgcggacaccagacggtggcactttgataacgggttggagatcatcgtggtcatg
aactctcccagcaacgacctcaatgacagtcatgttcagatttcctaccactccagccat
gagcccctgcccctggcctacgcggtgctctacctcacctgtgttgacatcgctctggat
tgtgacctgaactgcgagggcaggcaggacaggagctatgtggacaagcggcagtgggtc
tggggccccggagggtatggagccgtcctgctggtgaactgtgacagggatgatgtgacc
tgttatgaccaggacaactgtgaccggcacgtgaactgcctgcaagacctggaagacatg
tccgtcatggtcctgaggacgcaaggccctgccgccctcttcgacgaccacaaacttatc
ctccacacttcgagctatgacgccaagtgggcacgggtcttccacgcctgtggtcccgaa
gactcgtgtgaggcctaccggcacgtgctgggccagaacaaggtgtcgtacgaggtgccc
cgcttccacggggacgaggagcgcttcttcgtggagggcctctcgttccccgacgcccgc
ttcacggggctcgtgtccttccacgtcactctgctggacgactccaacgaggatttctcc
gagtccccgatcttcaccgacaccgtggtgttccgcgtggcgccctggattatgacgccc
agcaccctgccgcccctggaggtgtacgtgtgccgggtgcggaacaacacgtgctttgtg
gacgcggtggcggagctggccaggaaggccggctgtaagctgaccgtctgcccacagaag
gagaaccgcaatgaccgctggatccaggacgagatggagctgggctatgtccaggcgcca
cacaagactttcccggtggtctttgactcccccaggaacggggaactgcaagatttccct
tacaaaagaatcctgggcccagatttcggctatgtgactcgggaaccgcaggacagctct
gtgagtggcctggactccttcgggaatctggaggtcagccccccagtggtggccgatggg
aaagagtaccccctggggaggatcctcatcggcggcaacctgcctgggtccagcggccgc
cgggtcacccaggtggtgcgggacttcctctatgcgcagagggtacagcccccagtggag
ctctttgtggactggttggccgtgggccacgtggatgagtttctgagcttcgtccctgcg
cccgacgggaagggcttccggatgctcctggccagtcccagcgcctgcttcaagctcttc
caggaaaagcagaagtggggccacggcagggccctcctgttcaaaggggttgttggggat
aagccagtccacaccgtttccatcaaccaggtcctctccaatgtagacctcatcagctac
aataagtttgtgcagagctgcatcgactggaaccgggaggtgctgaagcgggagctgggc
ctgacggagcgggacatcgtggacatcccccagctcttcaagaccgagaggaaaaaggcg
gtggccttcttccctgacttggtgaacatgctggtgctggggaagcacctgggcatcccc
aagcccttcgggcccatcatcaacggccagtgctgcctggaggagaaggtgcggtccctg
ctggagccgctgggcctgcactgcaccttcatcgacgacttcaccccgtaccacatgctg
cacggggaggtccactgtggcaccaacgtgcgccggcagcccttctccttcaagtggtgg
aacatggtgccctga

DBGET integrated database retrieval system