KEGG   Canis familiaris (dog): 478264Help
Entry
478264            CDS       T01007                                 

Gene name
CHP1, CHP
Definition
calcineurin-like EF-hand protein 1
Orthology
K17610  
calcineurin B homologous protein 1
Organism
cfa  Canis familiaris (dog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
30
AA seq 195 aa AA seqDB search
MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAIN
PLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFR
LYDLDKDDKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVL
EKVDVEQKMSIRFLH
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgggttctcgggcttccacgttactgcgggacgaagagctcgaggagatcaagaaggag
actggcttttcccacagtcagatcacccgcctctacagccggttcaccagcctggacaaa
ggagagaacgggactctcagccgggaagatttccagcgaattccggaacttgccatcaac
ccactgggggaccggatcattaatgccttctttccagagggagaggaccaggtaaacttc
cgtggattcatgagaactttggctcattttcgacccattgaggataatgaaaaaagcaaa
gatgtgaatggaccagagccactcaatagccgaagcaacaaactgcactttgcttttcga
ctctatgacttggataaagatgacaagatttcccgtgatgaactgttacaggtgctacgt
atgatggtcggagtaaatatctcagatgagcagctaggcagcattgcagacaggaccatc
caggaggctgatcaggatggagacagcgccatatctttcacagaatttgttaaggttttg
gagaaagtagacgtagaacagaaaatgagcatccgatttcttcactga

DBGET integrated database retrieval system