KEGG   Canis familiaris (dog): 478279Help
Entry
478279            CDS       T01007                                 

Gene name
PDIA3
Definition
protein disulfide isomerase family A, member 3
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
cfa  Canis familiaris (dog)
Pathway
Protein processing in endoplasmic reticulum
Antigen processing and presentation
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:cfa04141]
Organismal Systems; Immune system; Antigen processing and presentation [PATH:cfa04612]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
30
AA seq 505 aa AA seqDB search
MRPRCRALLPGVALLFAAAGLASASDVLELTDDNFESRISDTGSAGLMLVEFFAPWCGHC
KRLAPEYEAAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRT
ADGIVSHLKKQAGPASVPLRTEEEFEKFISDKDASVVGFFQDLFSEAHSEFLKAASNLRD
NYRFAHTNVESLVNKYDDDGEGITLFRPSHLMNKFEDKTVAYIEQKMTSGKIKKFIQENI
FGICPHMTEDNKDLIQGKDLLVAYYDVDYEKNAKGSNYWRNRVMMVAKKFLDAGNKLNFA
VASRKTFSHELSDFGLESTAGEIPVVAIRTAKGEKFVMQEEFSRDGKALERFLQDYFDGN
LKRYLKSEPIPESNDGPVKVVVAENFDEIVNDENKDVLIEFYAPWCGHCKNLEPKYKELG
EKLRKDPNIIIAKMDATANDVPSPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYL
QREATNPPVIQEEKAKKKKKAQEDL
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgcgcccccgctgccgagcgctgctcccgggcgtggcgctgcttttcgccgcggccggt
ctcgcctctgcctccgacgtgctggaactcactgacgacaacttcgagagtcgcatctcc
gacacgggctctgcgggcctcatgctcgtcgagttcttcgctccctggtgtggacactgc
aagaggcttgcccctgagtatgaagccgcagcaaccagattaaaaggaatagtcccgtta
gcaaaggttgattgtactgccaacacaaacacctgtaataagtatggagtcagtggatat
ccaaccctgaagatatttagagatggtgaagaagctggtgcttatgatgggcctaggact
gccgatggaattgttagccatctgaagaagcaggcaggaccagcctcagttcctctcagg
accgaggaagaatttgagaagttcattagtgataaagatgcttctgtggtgggttttttc
caagatttatttagtgaagctcattctgagtttctaaaagcagccagcaacttgcgggat
aactaccgatttgcacacactaatgtggagtctctggtgaacaaatatgatgatgatgga
gagggtatcaccttgtttcgtccttcacatctgatgaataagtttgaggacaagactgtg
gcatatatagaacagaagatgaccagtggcaagattaaaaaatttatccaagaaaacatt
tttgggatctgccctcacatgacagaagacaataaagatttgatacagggcaaggactta
cttgtggcttactatgatgtggactatgaaaagaatgctaaaggttccaactactggaga
aacagagtgatgatggtagcaaagaaattcctagatgctggaaacaagctcaactttgct
gtagctagccgcaaaacttttagccacgaactttctgattttggcttggaaagcactgct
ggagagattcctgttgttgctatcagaactgcaaaaggagagaagtttgtcatgcaagag
gagttctcacgtgatggcaaggctcttgaaagattcctgcaggattactttgatggcaac
ctgaagaggtatctgaagtctgagcccatcccagaaagcaatgatgggccagtaaaggta
gtggtagcggagaattttgatgaaatagtgaatgacgaaaataaagatgtgctgattgaa
ttttatgctccttggtgtggtcactgtaagaatctggagcctaagtataaagaactggga
gagaagctcagaaaagaccccaatattatcatagccaagatggatgccacagccaatgat
gtgccttctccatatgaagtcagaggttttcctaccatctacttctctccagccaacaag
aagctaaatccaaagaaatatgaaggtggccgtgaattaagtgactttattagctatcta
caacgagaggcaacaaacccccctgtaattcaagaagaaaaagccaagaagaagaagaag
gcacaggaggatctctaa

DBGET integrated database retrieval system