KEGG   Canis familiaris (dog): 478299Help
Entry
478299            CDS       T01007                                 

Gene name
USP8
Definition
ubiquitin specific peptidase 8
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
cfa  Canis familiaris (dog)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    478299 (USP8)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     478299 (USP8)
Peptidases [BR:cfa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   478299 (USP8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
30
AA seq 1116 aa AA seqDB search
MPAVASVPKELYLSSSLKDLNKKTEVKPEKISTKNYVQSALKIFKTAEESRLDRDEERAY
VLYMKYVTVYNLIKKRPDFKQQQDYFHSILGLANIKKAIEEAERLSESLKLRYEEAEVRK
KLEEKDRQEEEQLQKQKRQEAGREDGGTSTKSSLENVMDSRDKTQKINGEKSEKNETTEK
GTITAKELYTMMMDENISLIIMDARRMQDYQDSHISNSLCVPEEAISPGVTASWIEAKLP
DDSKDTWKKRGSVEYVVLLDWFSSTKDLQLGTTLRSLKDALFKWESKTVLRNEPLVLAGG
YENWLLCYPQYTTNAKVTPPPRGKNEEVSISLDFTYPSLEESVPSKPTAQMPLPSVEINE
NIELINDQDERVAPLNISAPVEPIAASKSDVLPIIQPVPVVKNVPQIDRTKKPAVKLPED
HKIKSENKDHEQQSPQDGKVVPDRSTKPVFPPPTAMLTDEEKARIHAETALLMEKNKQEK
ELRERQQEEQKEKLRREEQEQKARKKQEAEENQITEKQQKAKEEMEKRESEQVKKEDKET
SKRSREITGVKRQSKSEHETTDAKKSAEDRGKRCPTPELQKKAVGDVPHASVAGDANSGK
PVKIKGQPESGILKTGTFRENTEDLERNKAREPLTRARSEEMGRIVPGLPSGWAKFLDPI
TGTFRYYHSPTNTVHMYPPEMAPSSAPPSTPPTHKAKPQIPAERDREPSKLKRSYSSPDI
TQAIQEEEKRKPTVTPTVNRENKPTCYPKAEITRLSASQIRNLNPVFGGSGPALTGLRNL
GNTCYMNSILQCLCNAPHLADYFNRNCYQDDINRSNLLGHKGEVAEEFGIIMKALWTGQY
RYISPKDFKITIGKINDQFAGYSQQDSQELLLFLMDGLHEDLNKADNRKRHKEENNDHLD
DFKAAEHAWQKHKQLNESIIVALFQGQFKSTVQCLTCHKKSRTFEAFMYLSLPLASTSKC
TLQDCLRLFSKEEKLTDNNRFYCSHCRTRRDSLKKIEIWKLPPVLLVHLKRFSYDGRWKQ
KLQTSVDFPLENLDLSQYVIGPKNNLKKYNLFSVSNHYGGLDGGHYTAYCKNAARQRWFK
FDDHEVSDISVSSVKSSAAYILFYTSLGPRAADVAT
NT seq 3351 nt NT seq  +upstreamnt  +downstreamnt
atgcctgctgtggcttcagttcctaaagaactctacctcagttcttcactaaaagacctc
aataagaagacagaagttaaaccagagaaaataagcacaaagaattatgtacagagtgcc
ctgaagattttcaagacagcagaagaaagcagattagatcgtgatgaggaaagggcctac
gtactatatatgaaatatgtgaccgtttataatcttatcaaaaaaaggcccgatttcaag
caacagcaggactactttcattcaatacttggactcgcaaacatcaaaaaagctattgaa
gaagctgaaagactctctgaaagccttaaactcagatatgaagaagccgaagttcggaaa
aaacttgaagaaaaggacagacaggaggaagaacagctgcagaaacagaaaaggcaagaa
gcaggaagagaggatggtggcacatcaactaaaagttccttggaaaatgtaatggattcc
agagacaaaacccaaaagataaatggtgaaaagagtgaaaaaaatgagaccacagagaaa
gggacaatcacagcaaaggagctgtatacaatgatgatggatgaaaacatcagcttgatt
ataatggatgcacgaagaatgcaggattatcaggattctcatatttcaaattctctctgt
gttcctgaagaagccatcagtccaggagtcactgctagttggattgaagcaaaactccca
gatgattctaaagacacatggaagaagagggggagtgtggaatatgtggtacttcttgac
tggtttagttctacaaaagatttacaacttggaacaactctacggagtctgaaagatgca
cttttcaagtgggaaagtaaaactgtcctgcgcaatgagcctttggttttagcaggaggc
tatgaaaactggctcctttgttacccccagtatactacaaatgctaaagtcactccaccc
ccacgaggcaagaatgaagaggtgtctatctcattggattttacttatccttcactggaa
gaatcagttccttctaaacctactgcccagatgccacttccttctgtagaaataaatgaa
aatatagaattgataaatgatcaagatgagagagtggcaccactgaacatatcagctcca
gtggaaccaattgctgcttctaaatctgatgttttacctataattcaaccagtgcctgtt
gtaaagaatgttccacagattgatcgtactaaaaaaccagcagtcaaattgcctgaagat
cataaaataaaatctgaaaataaagatcacgagcaacagtctcctcaggatggaaaagta
gttcctgatcgttccacaaagccagtatttccccctccgactgccatgttaacagatgaa
gaaaaggctcgtattcatgcagaaactgctcttctaatggagaaaaacaaacaagaaaaa
gaacttcgagaaaggcagcaagaagaacagaaagagaaactgaggagagaagaacaagaa
caaaaagccagaaagaaacaagaagctgaagaaaatcaaatcactgagaagcaacagaaa
gcaaaagaagaaatggaaaagagagaaagtgaacaggttaagaaagaagataaagaaact
tcaaagaggagcagagaaataacaggagtaaaaagacaaagtaaaagtgaacatgaaact
actgatgccaagaaatctgcagaagataggggcaaaaggtgtcccaccccagaactgcag
aagaaagcagtgggagatgtgccccatgcctctgtggcaggagatgcaaattcaggcaag
cctgttaagattaaaggacaaccagaaagtggaattctaaagactggaacttttagagag
aatacagaagacctcgaaagaaataaagctagagaacctttaacaagagcacgaagtgaa
gaaatggggaggatcgtaccaggactgccttctgggtgggccaagtttcttgacccaatc
actggaacttttcgttattatcattcacctaccaacactgttcatatgtatccaccggaa
atggctccttcatctgcacctccttccacccctccaactcataaagccaagccacagatt
cctgctgagcgggatagggaaccgtccaaactgaagcgctcctactcctccccagatata
acccaggctattcaagaggaagagaagaggaagccaacagtaactccaacagttaatcgg
gaaaacaagccaacatgctaccctaaagctgagatcacaaggctttctgcttctcagatt
cggaacctcaatcctgtctttggaggatctggaccagctctcactggacttcgtaatttg
ggaaatacttgttatatgaactccatactgcagtgcctatgtaatgctccacatttggct
gattatttcaaccgaaactgttaccaggatgatattaataggtcaaatctcttggggcat
aaaggtgaagtggctgaagaatttggcataattatgaaagccctgtggacaggacaatac
aggtacatcagtccaaaggactttaaaatcaccattgggaagatcaatgaccagtttgca
ggatatagccagcaagattcacaagaactgcttctgttcctaatggatggtctccatgaa
gatctaaataaagctgataatcggaagagacataaagaagaaaacaatgatcaccttgat
gactttaaagctgcagaacatgcctggcagaaacacaagcagctcaatgaatctattatt
gtcgcactttttcagggtcagttcaaatccacagtacagtgcctcacctgtcacaaaaag
tctaggacatttgaggccttcatgtatttgtctctacccttagcttctacaagtaaatgt
acattacaggattgccttagattattttccaaagaagagaagctcacagataacaacagg
ttttactgcagtcattgcagaactcgacgggattctttaaaaaagatagaaatctggaag
ttgccacctgtgcttttagtgcatctgaaacgtttttcctatgatggcaggtggaaacag
aaattacagacctctgtggacttcccattagaaaatcttgacttgtcacagtatgttatt
ggcccaaagaacaatttgaagaaatataatttgttttctgtttcaaatcactacggtggg
ctggatggaggccactacactgcctattgtaaaaatgcggcaagacagcggtggtttaaa
tttgatgatcatgaagtttctgatatctctgtttcttctgtgaagtcttcggcagcttat
atcctcttttatacttcactgggaccacgagcagctgatgtagccacataa

DBGET integrated database retrieval system