KEGG   Canis familiaris (dog): 478311Help
Entry
478311            CDS       T01007                                 

Gene name
MAPK6
Definition
mitogen-activated protein kinase 6
Orthology
K06855  
mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
cfa  Canis familiaris (dog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
30
AA seq 722 aa AA seqDB search
MAEKFESLMNIHGFDLGSRYMDLKPLGCGGNGLVFSAVDNDCDKRVAIKKIVLTDPQSVK
HALREIKIIRRLDHDNIVKVFEILGPSGSQLTDDVGSLTELNSVYIVQEYMETDLANVLE
QGPLLEEHARLFMYQLLRGLKYIHSANVLHRDLKPANLFINTEDLVLKIGDFGLARIMDP
HYSHKGHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFAEMLTGKTLFAGAHELEQ
MQLILESIPVVHEEDRQELLSVIPVYIRNDMTEPHKPLTQLLPGISREALDFLEQILTFS
PMDRLTAEEALSHPYMSIYSFPMDEPISSHPFHIEDEVDDILLMDETHSHIYNWERYHDC
QFSEHDWPIHNNFDIDEVQLDPRALSDVTDEEEVQVDPRKYLDGDREKYLEDPAFDTNYS
TDPCWQYPDHHENKYCDLECSHTCNYKTRSSSYLDNLVWRESEVNHYYEPKLIIDLSNWK
EQSKEKSDKKGKSKCERNGLVKAQIALEEASQQLAEKEREKNQGFDFDSFIAGTIQLSSQ
HEPTDVVDKLNDLNSSVSQLELKSLISKSVSREKQEKGMANLAQLEALYQSSWDSQFVGG
GEDCFLINQFCCEVRKDEQIEKENTYTSYLDKFFSRKEDTEMLETEPVEDGKLGERGNEE
GFLNNSGEFLFNKQLESIGIPQFHSPVGSPLKSIQATLTPSAMKSSPQIPHKTYSSILKH
LN
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaatttgaaagtctcatgaacattcatggttttgatctgggctctagatat
atggacttaaaaccattgggttgtggaggcaatggcttggttttttctgctgtagacaat
gactgtgacaaaagagtagccatcaagaaaattgtccttactgatccccagagtgtcaaa
catgctctacgtgaaatcaaaattattagaagacttgaccatgataacattgtgaaagtg
tttgaaattcttggtcctagcggaagccagttaacagacgatgtgggctctcttactgaa
ctgaacagtgtttacattgttcaggagtacatggagacagacttggctaatgtgctggag
cagggccctttactggaagagcatgccaggcttttcatgtatcagctgctacgtgggctc
aaatatattcactctgcaaacgtactgcacagagatctcaaaccagctaatcttttcatt
aatactgaagacttggtgctgaagataggtgacttcggtcttgcacggatcatggatccc
cattattcccataagggtcatctttctgaaggattggttactaaatggtacaggtctcca
cgtcttttactgtctcctaataattatactaaagccattgatatgtgggctgcaggctgc
atctttgctgaaatgctgactggtaaaaccctctttgcaggtgcacatgaacttgaacag
atgcagctgattttagaatctattcctgttgtacatgaggaagatcgtcaggagcttctc
agcgtaattccagtttacattagaaatgacatgactgagccacacaaacctttaactcag
ctgcttccaggaattagtcgagaagcactggatttcctggaacaaattttgacatttagc
ccaatggataggttgacagcagaagaagcgctttcccatccttacatgagcatatattct
tttccaatggatgagccaatttcaagtcatccttttcatattgaagatgaagttgatgat
attttacttatggatgaaactcatagtcacatttataactgggaaaggtaccatgattgt
caattttcagagcatgattggcctatacataacaactttgatattgatgaagttcagctt
gacccaagagctctgtctgatgtcactgatgaagaagaagtacaggttgatcctcgaaaa
tatttggatggagatcgtgaaaagtatttggaggatcctgcttttgataccaattattct
actgatccttgttggcagtacccagatcatcatgaaaacaaatactgtgatctggagtgt
agccatacgtgtaactacaaaacaaggtcatcatcatatttagataacttagtttggaga
gagagtgaagttaaccattattatgaacccaagcttattatagatctttccaattggaaa
gaacaaagcaaagaaaagtctgataagaaaggcaagtcaaaatgtgaaaggaatggattg
gttaaagcccagatagctctagaggaggcatcacagcaactggctgagaaagaaagggaa
aagaatcagggatttgactttgattcctttattgcaggaactattcagcttagttcacaa
catgagcctactgatgttgttgataaattaaatgacttgaatagctcagtgtcccaacta
gaattgaaaagtttgatatcaaagtcagtcagccgagaaaaacaggaaaagggaatggca
aatttggctcagttggaagccttataccaatcttcttgggatagccagtttgtgggtggt
ggggaggactgttttctcataaatcagttttgttgtgaggtgaggaaggatgaacaaatt
gagaaggaaaacacttacaccagttatttggacaagttctttagcaggaaagaggatact
gaaatgctagaaactgagccagtagaggatgggaagcttggagagagaggaaatgaggaa
gggtttctgaacaacagtggggagttcctctttaacaagcagctcgaatccataggcatc
ccgcagtttcacagtccggttgggtccccacttaagtcaatacaggccaccttaacacct
tctgctatgaaatcttcccctcagatccctcataagacatacagcagcattctgaaacat
ctgaactaa

DBGET integrated database retrieval system