KEGG   Canis familiaris (dog): 478332Help
Entry
478332            CDS       T01007                                 

Gene name
TPM1
Definition
tropomyosin 1 (alpha)
Orthology
K10373  
tropomyosin 1
Organism
cfa  Canis familiaris (dog)
Pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
MicroRNAs in cancer
Hypertrophic cardiomyopathy (HCM)
Dilated cardiomyopathy
Class
Organismal Systems; Circulatory system; Cardiac muscle contraction [PATH:cfa04260]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:cfa04261]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:cfa05206]
Human Diseases; Cardiovascular diseases; Hypertrophic cardiomyopathy (HCM) [PATH:cfa05410]
Human Diseases; Cardiovascular diseases; Dilated cardiomyopathy (DCM) [PATH:cfa05414]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
30
AA seq 284 aa AA seqDB search
MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKY
SEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA
DESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAE
ERAELSESKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAE
FAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSM
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggacgccatcaagaagaagatgcagatgctcaagctcgacaaggagaatgccttggat
cgagccgagcaggcggaggccgataagaaggcggcggaggacaggagcaagcagctggaa
gatgagctggtgtcgctgcaaaagaaactcaagggcaccgaagatgaactggacaaatac
tccgaggctctcaaagatgcccaggagaagttggagctggcggagaaaaaggccactgac
gctgaagccgatgtagcttctctgaacagacgcatccagctggttgaggaagagttggat
cgtgcccaggagcgactggcaacagctttgcagaagctggaggaggctgagaaggcagcg
gacgagagcgagagaggcatgaaagtcattgaaagccgagcccaaaaggatgaggagaaa
atggaaattcaggagatccaactgaaagaggccaagcacattgctgaagatgccgaccgc
aagtatgaagaggtggcccgtaagctggtcatcattgagagcgacctggaacgcgcagaa
gaacgggctgagctctcagaaagcaaatgtgccgagcttgaagaagaattgaaaactgtg
acgaacaacttgaagtcactggaggctcaggctgagaagtactcgcagaaggaagacaaa
tatgaggaagagatcaaggttctttctgacaagctgaaggaggccgagactcgggctgag
tttgcggagaggtcagtaactaaattggagaaaagcattgatgacttagaagacgagctg
tacgctcagaaactgaagtacaaagccatcagcgaggagctggaccacgctctcaacgat
atgacttccatgtaa

DBGET integrated database retrieval system