KEGG   Canis familiaris (dog): 478332Help
Entry
478332            CDS       T01007                                 

Gene name
TPM1
Definition
(RefSeq) tropomyosin 1 (alpha)
  KO
K10373  tropomyosin 1
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04260  Cardiac muscle contraction
cfa04261  Adrenergic signaling in cardiomyocytes
cfa05206  MicroRNAs in cancer
cfa05410  Hypertrophic cardiomyopathy (HCM)
cfa05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    478332 (TPM1)
   04261 Adrenergic signaling in cardiomyocytes
    478332 (TPM1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    478332 (TPM1)
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    478332 (TPM1)
   05414 Dilated cardiomyopathy (DCM)
    478332 (TPM1)
Cytoskeleton proteins [BR:cfa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     478332 (TPM1)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   478332 (TPM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tropomyosin Tropomyosin_1 CLZ Laminin_II IncA TMF_DNA_bd Laminin_I CENP-F_leu_zip DUF1664 DUF745 DUF3450 ERM XhlA ATG16 AAA_13 Golgin_A5 COG2 DUF16 Reo_sigmaC DUF3584 SlyX GAS
Motif
Other DBs
NCBI-GeneID: 478332
NCBI-ProteinID: XP_005638540
Ensembl: ENSCAFG00000016966
Position
30
AA seq 284 aa AA seqDB search
MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKY
SEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA
DESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAE
ERAELSESKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAE
FAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSM
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggacgccatcaagaagaagatgcagatgctcaagctcgacaaggagaatgccttggat
cgagccgagcaggcggaggccgataagaaggcggcggaggacaggagcaagcagctggaa
gatgagctggtgtcgctgcaaaagaaactcaagggcaccgaagatgaactggacaaatac
tccgaggctctcaaagatgcccaggagaagttggagctggcggagaaaaaggccactgac
gctgaagccgatgtagcttctctgaacagacgcatccagctggttgaggaagagttggat
cgtgcccaggagcgactggcaacagctttgcagaagctggaggaggctgagaaggcagcg
gacgagagcgagagaggcatgaaagtcattgaaagccgagcccaaaaggatgaggagaaa
atggaaattcaggagatccaactgaaagaggccaagcacattgctgaagatgccgaccgc
aagtatgaagaggtggcccgtaagctggtcatcattgagagcgacctggaacgcgcagaa
gaacgggctgagctctcagaaagcaaatgtgccgagcttgaagaagaattgaaaactgtg
acgaacaacttgaagtcactggaggctcaggctgagaagtactcgcagaaggaagacaaa
tatgaggaagagatcaaggttctttctgacaagctgaaggaggccgagactcgggctgag
tttgcggagaggtcagtaactaaattggagaaaagcattgatgacttagaagacgagctg
tacgctcagaaactgaagtacaaagccatcagcgaggagctggaccacgctctcaacgat
atgacttccatgtaa

DBGET integrated database retrieval system