KEGG   Canis familiaris (dog): 478332Help
Entry
478332            CDS       T01007                                 

Gene name
TPM1
Definition
tropomyosin 1 (alpha)
Orthology
K10373  
tropomyosin 1
Organism
cfa  Canis familiaris (dog)
Pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
MicroRNAs in cancer
Hypertrophic cardiomyopathy (HCM)
Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    478332 (TPM1)
   04261 Adrenergic signaling in cardiomyocytes
    478332 (TPM1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    478332 (TPM1)
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    478332 (TPM1)
   05414 Dilated cardiomyopathy (DCM)
    478332 (TPM1)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   478332 (TPM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
30
AA seq 284 aa AA seqDB search
MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKY
SEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA
DESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAE
ERAELSESKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAE
FAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSM
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggacgccatcaagaagaagatgcagatgctcaagctcgacaaggagaatgccttggat
cgagccgagcaggcggaggccgataagaaggcggcggaggacaggagcaagcagctggaa
gatgagctggtgtcgctgcaaaagaaactcaagggcaccgaagatgaactggacaaatac
tccgaggctctcaaagatgcccaggagaagttggagctggcggagaaaaaggccactgac
gctgaagccgatgtagcttctctgaacagacgcatccagctggttgaggaagagttggat
cgtgcccaggagcgactggcaacagctttgcagaagctggaggaggctgagaaggcagcg
gacgagagcgagagaggcatgaaagtcattgaaagccgagcccaaaaggatgaggagaaa
atggaaattcaggagatccaactgaaagaggccaagcacattgctgaagatgccgaccgc
aagtatgaagaggtggcccgtaagctggtcatcattgagagcgacctggaacgcgcagaa
gaacgggctgagctctcagaaagcaaatgtgccgagcttgaagaagaattgaaaactgtg
acgaacaacttgaagtcactggaggctcaggctgagaagtactcgcagaaggaagacaaa
tatgaggaagagatcaaggttctttctgacaagctgaaggaggccgagactcgggctgag
tttgcggagaggtcagtaactaaattggagaaaagcattgatgacttagaagacgagctg
tacgctcagaaactgaagtacaaagccatcagcgaggagctggaccacgctctcaacgat
atgacttccatgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system