KEGG   Canis familiaris (dog): 478347Help
Entry
478347            CDS       T01007                                 

Gene name
MAP2K1
Definition
mitogen-activated protein kinase kinase 1 (EC:2.7.12.2)
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
cfa  Canis familiaris (dog)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Rap1 signaling pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
HIF-1 signaling pathway
FoxO signaling pathway
Oocyte meiosis
PI3K-Akt signaling pathway
Vascular smooth muscle contraction
Dorso-ventral axis formation
VEGF signaling pathway
Osteoclast differentiation
Focal adhesion
Gap junction
Signaling pathways regulating pluripotency of stem cells
Toll-like receptor signaling pathway
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
TNF signaling pathway
Long-term potentiation
Neurotrophin signaling pathway
Cholinergic synapse
Serotonergic synapse
Long-term depression
Regulation of actin cytoskeleton
Insulin signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Melanogenesis
Prolactin signaling pathway
Thyroid hormone signaling pathway
Oxytocin signaling pathway
Prion diseases
Alcoholism
Hepatitis B
Influenza A
Pathways in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Colorectal cancer
Renal cell carcinoma
Pancreatic cancer
Endometrial cancer
Glioma
Prostate cancer
Thyroid cancer
Melanoma
Bladder cancer
Chronic myeloid leukemia
Acute myeloid leukemia
Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    478347 (MAP2K1)
   04015 Rap1 signaling pathway
    478347 (MAP2K1)
   04010 MAPK signaling pathway
    478347 (MAP2K1)
   04012 ErbB signaling pathway
    478347 (MAP2K1)
   04370 VEGF signaling pathway
    478347 (MAP2K1)
   04668 TNF signaling pathway
    478347 (MAP2K1)
   04066 HIF-1 signaling pathway
    478347 (MAP2K1)
   04068 FoxO signaling pathway
    478347 (MAP2K1)
   04024 cAMP signaling pathway
    478347 (MAP2K1)
   04022 cGMP - PKG signaling pathway
    478347 (MAP2K1)
   04151 PI3K-Akt signaling pathway
    478347 (MAP2K1)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    478347 (MAP2K1)
  Cell growth and death
   04114 Oocyte meiosis
    478347 (MAP2K1)
  Cellular commiunity
   04510 Focal adhesion
    478347 (MAP2K1)
   04540 Gap junction
    478347 (MAP2K1)
   04550 Signaling pathways regulating pluripotency of stem cells
    478347 (MAP2K1)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    478347 (MAP2K1)
   04650 Natural killer cell mediated cytotoxicity
    478347 (MAP2K1)
   04660 T cell receptor signaling pathway
    478347 (MAP2K1)
   04662 B cell receptor signaling pathway
    478347 (MAP2K1)
   04664 Fc epsilon RI signaling pathway
    478347 (MAP2K1)
   04666 Fc gamma R-mediated phagocytosis
    478347 (MAP2K1)
   04062 Chemokine signaling pathway
    478347 (MAP2K1)
  Endocrine system
   04910 Insulin signaling pathway
    478347 (MAP2K1)
   04912 GnRH signaling pathway
    478347 (MAP2K1)
   04915 Estrogen signaling pathway
    478347 (MAP2K1)
   04914 Progesterone-mediated oocyte maturation
    478347 (MAP2K1)
   04917 Prolactin signaling pathway
    478347 (MAP2K1)
   04921 Oxytocin signaling pathway
    478347 (MAP2K1)
   04919 Thyroid hormone signaling pathway
    478347 (MAP2K1)
   04916 Melanogenesis
    478347 (MAP2K1)
  Circulatory system
   04270 Vascular smooth muscle contraction
    478347 (MAP2K1)
  Nervous system
   04725 Cholinergic synapse
    478347 (MAP2K1)
   04726 Serotonergic synapse
    478347 (MAP2K1)
   04720 Long-term potentiation
    478347 (MAP2K1)
   04730 Long-term depression
    478347 (MAP2K1)
   04722 Neurotrophin signaling pathway
    478347 (MAP2K1)
  Development
   04320 Dorso-ventral axis formation
    478347 (MAP2K1)
   04380 Osteoclast differentiation
    478347 (MAP2K1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    478347 (MAP2K1)
   05206 MicroRNAs in cancer
    478347 (MAP2K1)
   05205 Proteoglycans in cancer
    478347 (MAP2K1)
   05210 Colorectal cancer
    478347 (MAP2K1)
   05212 Pancreatic cancer
    478347 (MAP2K1)
   05214 Glioma
    478347 (MAP2K1)
   05216 Thyroid cancer
    478347 (MAP2K1)
   05221 Acute myeloid leukemia
    478347 (MAP2K1)
   05220 Chronic myeloid leukemia
    478347 (MAP2K1)
   05218 Melanoma
    478347 (MAP2K1)
   05211 Renal cell carcinoma
    478347 (MAP2K1)
   05219 Bladder cancer
    478347 (MAP2K1)
   05215 Prostate cancer
    478347 (MAP2K1)
   05213 Endometrial cancer
    478347 (MAP2K1)
   05223 Non-small cell lung cancer
    478347 (MAP2K1)
  Neurodegenerative diseases
   05020 Prion diseases
    478347 (MAP2K1)
  Substance dependence
   05034 Alcoholism
    478347 (MAP2K1)
  Infectious diseases
   05164 Influenza A
    478347 (MAP2K1)
   05161 Hepatitis B
    478347 (MAP2K1)
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     478347 (MAP2K1)
Protein kinases [BR:cfa01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   478347 (MAP2K1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
30
AA seq 381 aa AA seqDB search
MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKV
GELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHE
CNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYL
REKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHY
SVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFGCQVEGDVAETPPRPRTPGRPLSSY
GMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAF
IKRSDGEEVDFAGWLCSPHWP
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagaagaagccgacgcccatccagctgaacccggcccccgacggctcggcggtg
aacgggaccagctcggcggagaccaacctggaggccttgcagaagaagctggaggagctg
gagcttgatgagcagcagcggaagcgccttgaggcctttctcacccagaagcagaaggtc
ggggaactgaaggatgacgacttcgagaagatcagtgagctgggtgctggcaacggtggc
gtggtgttcaaggtctcccacaagccgtccggcctagtcatggccagaaagctaattcac
ctggagatcaaacctgcaatccggaaccagatcataagggagctacaggttctacatgag
tgcaactccccgtacatcgtgggcttctatggtgcattctacagcgatggcgagatcagt
atctgcatggagcacatggatgggggttccttggatcaagtcctgaagaaagctggaaga
attcctgaacaaattctaggaaaagttagcatcgctgtaataaaaggtctgacatacctg
agagagaagcacaagattatgcacagagatgtcaagccttccaacatcctcgtgaactcc
cgtggggagatcaagctctgtgactttggggtcagcgggcagctcattgactccatggcc
aactccttcgtgggcacaaggtcctacatgtcgccagaaagactccaggggactcattac
tccgtgcagtcggacatctggagcatggggctctctctggtggagatggcagttgggagg
tatcccatccctcctccggatgccaaggagctggagctgatgtttgggtgccaagtggag
ggagacgtggctgagaccccacccagaccaaggaccccgggaagaccccttagctcttat
ggaatggacagccgaccgcccatggcaatttttgagctgttggattacatagtcaacgag
ccccctccaaaactgcccagtggagtattcagtctggaatttcaagattttgtgaataaa
tgcttaataaaaaacccagcagagagagcagatctgaagcaactcatggttcatgccttc
atcaagagatctgacggtgaagaagtggattttgcaggttggctctgctccccccattgg
ccttaa

DBGET integrated database retrieval system