KEGG   Canis familiaris (dog): 478448Help
Entry
478448            CDS       T01007                                 

Gene name
GK2
Definition
glycerol kinase 2
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cfa  Canis familiaris (dog)
Pathway
Glycerolipid metabolism
Metabolic pathways
PPAR signaling pathway
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:cfa00561]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:cfa03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
32
AA seq 554 aa AA seqDB search
MAAPKKTVVGPLVGAVVQGTNSTRFLVFSSKTADLLSHHQVELTEDFPREEWVEQDPKEI
LQSVYECIERTCQKLAELHIEVSNIKATGVSNQRETTVIWDKLTGEPFYNAIVWLDLRTQ
PTLENLSKKIPGNNNFVKSETGLPLSTYFSAVKLRWILDNVRQVQKAVEEGRALLGTIDS
WLIWSVTGGVNGGVHCTDVTNASRTMLSNIHSLEWDKELCDFFDIPMDILRNVWSSSDIY
GRIKAGSLEGEPISGCLGDQSAALVGQMCFQEGQAKNTYSTGRFLLCNTGHKCVFSAHGL
LTTVAYKPGRDKPVCYALEGSVGIAGAVIRWLRDNLGIINTSEEIETLAKDVGTSYGCYF
VPAFSGLYAPFWEPSARGIICGLSQFTSKNHIAFAALESVCFQTREILDAMNYDCGIPLS
HLQVDGAMTNNRILMQLQADILHIPVIKPSMPETTALGAAMAAGAAEGVGVWSLKPEDLS
VIFMERFEPQIKATESEIRYSTWKKAVRKSMGWVTTQYPESGDPTIFSCLPLGFFIVSSM
IMLIGARYISGISY
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atggcagccccaaagaaaacggttgtggggccgttggtgggggcagtggtccaggggacg
aattccactcgctttctggttttcagttcaaaaacagcagatctgcttagtcaccatcaa
gtggaattaacagaagatttcccaagagaagaatgggtggagcaagaccctaaggaaatt
cttcagtctgtttatgagtgtatagagagaacatgccagaaacttgctgaactgcacatt
gaagtatccaacataaaagccactggtgtcagcaatcagagggaaaccactgtaatctgg
gacaagttaactggagagccgttctataatgctatagtgtggcttgatctaagaacccag
cctaccctcgaaaaccttagtaaaaaaattccaggaaataataactttgtcaagtccgag
acaggccttccacttagcacttacttcagtgcagtgaaacttcgttggattcttgacaat
gtgaggcaagttcaaaaggctgttgaagaaggtagagctcttttgggtaccattgattca
tggctaatctggagtgtgacaggaggagttaatggaggtgtccactgtacagatgtaaca
aatgcaagcaggacgatgctttccaacatccattccttggaatgggataaagagctttgt
gacttttttgacattccgatggacattcttcggaatgtatggagttcttctgatatctat
ggccgcataaaagctgggtctttggaaggtgagccaatatctgggtgcttgggggaccag
tctgctgcattggtaggacaaatgtgcttccaagagggacaggccaaaaacacgtacagc
acaggccgtttcttactatgtaatacaggtcataagtgtgtattttctgcacatggcctt
ctgaccacagtagcttataaaccaggcagagacaagccagtatgttatgctttagaaggt
tctgttggtatagctggtgctgttattcgctggttaagagacaatcttggaattataaac
acctcagaggaaattgaaacacttgctaaagatgtaggtacttcttacggctgctacttt
gtcccagctttttcaggcttatatgcacctttttgggagcccagtgcaagaggaataatc
tgtggtctctctcagtttaccagtaaaaatcatattgcttttgctgcattagaatctgtt
tgtttccaaacccgagagattttggatgccatgaactatgactgtggaattcccctcagt
catttgcaggtagatggagcaatgaccaacaacagaattcttatgcaactacaagcagac
attctgcatattccagtaataaagccctctatgcctgaaacaactgcactgggagctgcc
atggcagcaggagctgcagaaggggtgggcgtttggagtcttaaacctgaggatttgtca
gtcatctttatggaacggtttgagccacagatcaaggccacagaaagtgaaattcgttat
tctacgtggaagaaagctgtgaggaagtcgatgggttgggttacaactcagtatcctgaa
agtggtgatcctactatcttctcttgtctgcccttgggcttttttatagtgagtagcatg
ataatgttaattggagcaagatatatttcaggtatatcatactaa

DBGET integrated database retrieval system