KEGG   Canis familiaris (dog): 478448Help
Entry
478448            CDS       T01007                                 

Gene name
GK2
Definition
glycerol kinase 2
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cfa  Canis familiaris (dog)
Pathway
Glycerolipid metabolism
Metabolic pathways
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    478448 (GK2)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    478448 (GK2)
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     478448 (GK2)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   478448 (GK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
32
AA seq 554 aa AA seqDB search
MAAPKKTVVGPLVGAVVQGTNSTRFLVFSSKTADLLSHHQVELTEDFPREEWVEQDPKEI
LQSVYECIERTCQKLAELHIEVSNIKATGVSNQRETTVIWDKLTGEPFYNAIVWLDLRTQ
PTLENLSKKIPGNNNFVKSETGLPLSTYFSAVKLRWILDNVRQVQKAVEEGRALLGTIDS
WLIWSVTGGVNGGVHCTDVTNASRTMLSNIHSLEWDKELCDFFDIPMDILRNVWSSSDIY
GRIKAGSLEGEPISGCLGDQSAALVGQMCFQEGQAKNTYSTGRFLLCNTGHKCVFSAHGL
LTTVAYKPGRDKPVCYALEGSVGIAGAVIRWLRDNLGIINTSEEIETLAKDVGTSYGCYF
VPAFSGLYAPFWEPSARGIICGLSQFTSKNHIAFAALESVCFQTREILDAMNYDCGIPLS
HLQVDGAMTNNRILMQLQADILHIPVIKPSMPETTALGAAMAAGAAEGVGVWSLKPEDLS
VIFMERFEPQIKATESEIRYSTWKKAVRKSMGWVTTQYPESGDPTIFSCLPLGFFIVSSM
IMLIGARYISGISY
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atggcagccccaaagaaaacggttgtggggccgttggtgggggcagtggtccaggggacg
aattccactcgctttctggttttcagttcaaaaacagcagatctgcttagtcaccatcaa
gtggaattaacagaagatttcccaagagaagaatgggtggagcaagaccctaaggaaatt
cttcagtctgtttatgagtgtatagagagaacatgccagaaacttgctgaactgcacatt
gaagtatccaacataaaagccactggtgtcagcaatcagagggaaaccactgtaatctgg
gacaagttaactggagagccgttctataatgctatagtgtggcttgatctaagaacccag
cctaccctcgaaaaccttagtaaaaaaattccaggaaataataactttgtcaagtccgag
acaggccttccacttagcacttacttcagtgcagtgaaacttcgttggattcttgacaat
gtgaggcaagttcaaaaggctgttgaagaaggtagagctcttttgggtaccattgattca
tggctaatctggagtgtgacaggaggagttaatggaggtgtccactgtacagatgtaaca
aatgcaagcaggacgatgctttccaacatccattccttggaatgggataaagagctttgt
gacttttttgacattccgatggacattcttcggaatgtatggagttcttctgatatctat
ggccgcataaaagctgggtctttggaaggtgagccaatatctgggtgcttgggggaccag
tctgctgcattggtaggacaaatgtgcttccaagagggacaggccaaaaacacgtacagc
acaggccgtttcttactatgtaatacaggtcataagtgtgtattttctgcacatggcctt
ctgaccacagtagcttataaaccaggcagagacaagccagtatgttatgctttagaaggt
tctgttggtatagctggtgctgttattcgctggttaagagacaatcttggaattataaac
acctcagaggaaattgaaacacttgctaaagatgtaggtacttcttacggctgctacttt
gtcccagctttttcaggcttatatgcacctttttgggagcccagtgcaagaggaataatc
tgtggtctctctcagtttaccagtaaaaatcatattgcttttgctgcattagaatctgtt
tgtttccaaacccgagagattttggatgccatgaactatgactgtggaattcccctcagt
catttgcaggtagatggagcaatgaccaacaacagaattcttatgcaactacaagcagac
attctgcatattccagtaataaagccctctatgcctgaaacaactgcactgggagctgcc
atggcagcaggagctgcagaaggggtgggcgtttggagtcttaaacctgaggatttgtca
gtcatctttatggaacggtttgagccacagatcaaggccacagaaagtgaaattcgttat
tctacgtggaagaaagctgtgaggaagtcgatgggttgggttacaactcagtatcctgaa
agtggtgatcctactatcttctcttgtctgcccttgggcttttttatagtgagtagcatg
ataatgttaattggagcaagatatatttcaggtatatcatactaa

DBGET integrated database retrieval system