KEGG   Canis familiaris (dog): 478589Help
Entry
478589            CDS       T01007                                 

Gene name
PDIA5
Definition
(RefSeq) protein disulfide isomerase family A member 5
  KO
K09583  protein disulfide isomerase family A, member 5 [EC:5.3.4.1]
Organism
cfa  Canis familiaris (dog)
Brite
Enzymes [BR:cfa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     478589 (PDIA5)
Chaperones and folding catalysts [BR:cfa03110]
 Protein folding catalysts
  Protein disulfide isomerase
   478589 (PDIA5)
Membrane trafficking [BR:cfa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    478589 (PDIA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_2 Thioredoxin_7 Thioredoxin_8 OST3_OST6 AhpC-TSA Redoxin Thioredoxin_6 TraF Thioredoxin_9 HyaE Thioredoxin_3
Motif
Other DBs
NCBI-GeneID: 478589
NCBI-ProteinID: XP_535765
Ensembl: ENSCAFG00000012051
UniProt: F1PAN3
Position
33
AA seq 519 aa AA seqDB search
MARLGPAGLLLAVWVVLPVWLSSTKVSSLIERISDPKDLKKLLRTRNNVLVLYSKSEAAA
ESHLRLLSTVAQAVKGQGTICWVDCGDAESRKLCKKMKVDLSPKDKKVELFHYQDGAFHT
EYNRAVTFKSIVAFLKDPKGPPLWEEDPGAKDVVHIDSEKDFRRLLKKEEKPLLMMFYAP
WCSMCKRIMPHFQKAATQLRGHFVLAGMNIYPSEFENVKEEYNVRGYPTICYFEKGRFLF
QYDNYGSTAEDIVEWLKNPQPPQPQVPETPWADEGGSVYHLTDEDFDQFVKEHSSVLVMF
HAPWCGHCKKMKPEFENAAEVLHGEADSSGVLAAVDATVNKALAERFHISEFPTLKYFKN
GEKYAVPALRTKKNFIEWMRNPEAPPPPEPTWEEQQTSVLHLAGDSFRETLKKKKHTLVM
FYAPWCPHCKKVIPHFTATADVFKDDRKIACAAVDCVKEKNQDLCQQEAVKAYPTFHYYH
YGKFAEKYDSDRTESGFTSFIRALREGDHERLGKKKEEL
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atggcgcggctcgggccggcggggctgctgctggccgtctgggtggtcctgccagtgtgg
ctgtcctccacaaaggtctcctcactcatcgagagaatttctgaccccaaggacttgaaa
aaacttctcaggacccggaataacgtgctggtgctttactccaaatctgaggccgcagct
gaaagtcatctcaggttattatccactgtggcccaggcagtgaaaggacaaggcaccatc
tgctgggtagactgtggtgatgccgagagtagaaaattgtgcaagaagatgaaagttgac
ctgagcccaaaggacaaaaaggttgaattattccattaccaggatggtgcatttcatact
gaatataaccgagctgtgacatttaagtccatagtggcctttctgaaggatccaaaaggg
cccccactgtgggaggaagatcctggagccaaagatgttgtccacattgacagtgaaaag
gacttcagacggctcctgaaaaaggaagagaagccgctcctgatgatgttctatgccccc
tggtgcagcatgtgcaagaggataatgccacatttccagaaggctgcaacccagctgcga
ggccacttcgtgctggctgggatgaatatctacccctcggaatttgaaaacgtcaaagag
gagtataatgtgcgaggctaccccaccatctgctatttcgagaaaggacggtttctgttc
cagtatgacaactatggatccacggccgaggacattgtggaatggctgaagaatccgcag
ccgccacagccccaggtccccgagactccctgggcagatgagggcggctccgtttatcac
ctgaccgacgaagactttgaccagtttgtgaaggaacactcctctgttctcgtcatgttc
cacgccccatggtgtggacactgtaagaaaatgaagccagagtttgagaatgcagcggaa
gtcctccatggagaagcagacagctctggtgtccttgcagctgtcgatgccactgtcaac
aaggccctggcagagagattccacatctccgagtttcctacactgaagtattttaagaac
ggagagaaatacgcagtgcctgcgctcagaacaaagaagaactttattgagtggatgcga
aaccctgaggcccctccacccccagagcccacctgggaagagcagcagaccagcgtgctg
cacctggcaggggacagcttccgggagacgctgaagaagaagaagcacaccttggtcatg
ttctatgccccttggtgcccgcactgtaagaaggtcatcccgcactttaccgccaccgcc
gacgtcttcaaggatgaccgaaagattgcctgtgctgctgttgactgcgtcaaagagaag
aaccaggacctgtgtcagcaggaggctgtcaaggcctaccccacgttccactactaccat
tatgggaagtttgcagagaagtatgacagcgatcggacggaatcggggtttaccagtttc
attcgagcgctccgggaaggagaccacgagagactggggaagaagaaggaagagttgtga

DBGET integrated database retrieval system