KEGG   Canis familiaris (dog): 478799Help
Entry
478799            CDS       T01007                                 

Gene name
HAT1
Definition
histone acetyltransferase 1
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
cfa  Canis familiaris (dog)
Pathway
Alcoholism
Class
Human Diseases; Substance dependence; Alcoholism [PATH:cfa05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
36
AA seq 413 aa AA seqDB search
MEKFLVEYKSAVEKKLAEYKCNTNTAIELKLVRFPEDLENDIRTFFPEYTHQLFGDDETA
FGYKGLKILLYYIAGSLSTMFRVEYASKVDENFDCVEADDVEGKIRQIIPPGFCTNTNDF
LSLLEKEVDFKPFGTLLHTYSVLSPTGGENFTFQIYKADMTCRGFREYHERLQTFLMWFI
ETASFIDVDDERWHYFLVFEKYNKDGATLFATVGYMTVYNYYVYPDKTRPRVSQMLILTP
FQGQGHGAQLLETVHRYYIASPSVLDITAEDPSKSYVKLRDFVLVKLCQDLPCFSREKLM
QGFSEAMAIEAQQKFKINKQHARRVYEILRLLVTDMSDAEQYRSYRLDIKRRLISPYKKK
QRDLAKMRKCLRPEELTNQMNQIEISMQHEQLEESFQELVEDYRRVIERLAQE
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggagaaatttttggttgagtacaagagtgcagtggagaagaagctggcggagtacaaa
tgtaacaccaacacagcaattgaactaaaattagttcgttttcctgaagatctggagaat
gacattagaactttctttcctgaatatacccatcaactctttggggatgatgaaactgct
tttggttacaagggtctgaagatcctgttatactatattgccggtagcttgtcaacaatg
ttccgtgttgaatatgcatctaaagttgatgagaattttgactgtgtagaggcagatgat
gttgagggcaaaattagacaaatcatcccacctggattttgtacaaacacaaatgatttt
ctctctttgctggaaaaagaagttgatttcaagccatttggaaccttactccatacatac
tctgttctcagtccaacaggaggggaaaactttacctttcaaatatacaaggctgacatg
acatgtagaggctttcgagaatatcatgaaaggcttcagacctttttgatgtggtttatt
gaaactgctagctttattgacgtggatgatgaaagatggcactactttctagtatttgag
aagtataataaggatggagctacgctctttgcgaccgtaggctacatgacagtctataat
tactatgtgtacccagacaaaacccggccacgtgtaagtcagatgctgatactgactcca
tttcaaggtcaaggtcatggtgctcaacttcttgaaacagttcataggtactacattgca
tctccttctgttcttgatattacagcggaagatccatccaaaagctatgtgaaattaaga
gactttgtgcttgtgaagctttgtcaagatttgccttgtttttcccgggaaaagttgatg
caaggattcagtgaagccatggcaatagaagcacaacagaagttcaaaataaataagcaa
catgctagacgggtttatgaaatccttcgactattggtaactgacatgagtgatgctgaa
caatacagaagctatagactggacattaaaagaagactaattagcccatataagaaaaaa
cagagagatcttgctaaaatgagaaaatgtctcagaccagaagaactgacaaaccagatg
aaccaaatagaaataagcatgcaacatgaacagctggaagaaagctttcaggaacttgtg
gaagattaccgacgtgttattgaacgccttgctcaagaataa

DBGET integrated database retrieval system