KEGG   Canis familiaris (dog): 478799Help
Entry
478799            CDS       T01007                                 

Gene name
HAT1
Definition
histone acetyltransferase 1
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
cfa  Canis familiaris (dog)
Pathway
Alcoholism
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Human Diseases
  Substance dependence
   05034 Alcoholism
    478799 (HAT1)
Enzymes [BR:cfa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     478799 (HAT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
36
AA seq 413 aa AA seqDB search
MEKFLVEYKSAVEKKLAEYKCNTNTAIELKLVRFPEDLENDIRTFFPEYTHQLFGDDETA
FGYKGLKILLYYIAGSLSTMFRVEYASKVDENFDCVEADDVEGKIRQIIPPGFCTNTNDF
LSLLEKEVDFKPFGTLLHTYSVLSPTGGENFTFQIYKADMTCRGFREYHERLQTFLMWFI
ETASFIDVDDERWHYFLVFEKYNKDGATLFATVGYMTVYNYYVYPDKTRPRVSQMLILTP
FQGQGHGAQLLETVHRYYIASPSVLDITAEDPSKSYVKLRDFVLVKLCQDLPCFSREKLM
QGFSEAMAIEAQQKFKINKQHARRVYEILRLLVTDMSDAEQYRSYRLDIKRRLISPYKKK
QRDLAKMRKCLRPEELTNQMNQIEISMQHEQLEESFQELVEDYRRVIERLAQE
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggagaaatttttggttgagtacaagagtgcagtggagaagaagctggcggagtacaaa
tgtaacaccaacacagcaattgaactaaaattagttcgttttcctgaagatctggagaat
gacattagaactttctttcctgaatatacccatcaactctttggggatgatgaaactgct
tttggttacaagggtctgaagatcctgttatactatattgccggtagcttgtcaacaatg
ttccgtgttgaatatgcatctaaagttgatgagaattttgactgtgtagaggcagatgat
gttgagggcaaaattagacaaatcatcccacctggattttgtacaaacacaaatgatttt
ctctctttgctggaaaaagaagttgatttcaagccatttggaaccttactccatacatac
tctgttctcagtccaacaggaggggaaaactttacctttcaaatatacaaggctgacatg
acatgtagaggctttcgagaatatcatgaaaggcttcagacctttttgatgtggtttatt
gaaactgctagctttattgacgtggatgatgaaagatggcactactttctagtatttgag
aagtataataaggatggagctacgctctttgcgaccgtaggctacatgacagtctataat
tactatgtgtacccagacaaaacccggccacgtgtaagtcagatgctgatactgactcca
tttcaaggtcaaggtcatggtgctcaacttcttgaaacagttcataggtactacattgca
tctccttctgttcttgatattacagcggaagatccatccaaaagctatgtgaaattaaga
gactttgtgcttgtgaagctttgtcaagatttgccttgtttttcccgggaaaagttgatg
caaggattcagtgaagccatggcaatagaagcacaacagaagttcaaaataaataagcaa
catgctagacgggtttatgaaatccttcgactattggtaactgacatgagtgatgctgaa
caatacagaagctatagactggacattaaaagaagactaattagcccatataagaaaaaa
cagagagatcttgctaaaatgagaaaatgtctcagaccagaagaactgacaaaccagatg
aaccaaatagaaataagcatgcaacatgaacagctggaagaaagctttcaggaacttgtg
gaagattaccgacgtgttattgaacgccttgctcaagaataa

DBGET integrated database retrieval system