KEGG   Canis familiaris (dog): 478866Help
Entry
478866            CDS       T01007                                 

Gene name
CLK1
Definition
CDC-like kinase 1
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
cfa  Canis familiaris (dog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
37
AA seq 484 aa AA seqDB search
MRHSKRTYCPDWDEKDWDCGKWRSSSSHKRRKRSHSSARENKRCKYNHSKTSDSHYLESR
SINEKDYHSRRYIDEYRNDYSQGCEPGHRHRDHESRYQNHSSKSSGRSGRSSYKSKHRNH
HSTSHHRSHGKSHRRKRTRSVEDDEEGHLICQSGDVLSARYEIVDTLGEGAFGKVVECID
HKAGGRHVAVKIVKNVDRYCEAARSEIQVLEHLNTTDPSSTFRCVQMLEWFEHHGHICIV
FELLGLSTYDFIKENGFLPFRLDHIRKMAYQICKSVNFLHSNKLTHTDLKPENILFVQSD
YTEAYNPKMKRDERTLINADIKVVDFGSATYDDEHHSTLVSTRHYRAPEVILALGWSQPC
DVWSIGCILIEYYLGFTVFPTHDSKEHLAMMERILGPLPKHMIQKTRKRKYFHHDRLDWD
EHSSAGRYVSRRCKPLKEFMLSQDAEHELLFDLIEKMLEYDPAKRITLKEALKHPFFYPL
KKAT
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgagacactcaaagagaacttattgtcctgactgggatgaaaaagattgggactgcgga
aaatggagaagcagcagcagtcataaaagaaggaagagatcacatagcagtgcgcgggag
aacaagcgctgcaaatataatcactctaaaacatctgatagccattatttggaaagtaga
tccataaatgagaaagattatcatagtcgacgctacattgatgaatacagaaatgactac
agtcaaggatgtgaacctggacatcgccatagagaccatgaaagcagatatcagaaccat
agtagcaagtcttctgggagaagtggaagaagtagttataaaagcaaacacaggaatcac
catagtacttcacaccatcgttcacatgggaagagtcaccgaaggaaaagaaccaggagt
gtagaggatgatgaggagggtcacctgatctgtcagagtggagacgtactaagtgcaaga
tatgaaattgttgatactttaggagaaggagcttttggaaaagtcgtggagtgcattgat
cataaagcaggaggtagacatgtagcagtaaaaatagttaaaaatgtggatagatactgt
gaagctgctcgctcagaaatacaagttctggaacacttgaatacaacagaccccagcagt
acattccgctgtgtccagatgttggagtggtttgaacatcatggtcacatttgcattgtg
tttgaactactaggacttagtacttacgacttcattaaagaaaatggttttctgccgttt
cgtctggatcatatcaggaagatggcatatcagatatgcaagtcagtgaattttctgcac
agtaacaagttgactcacacagacttaaagcctgaaaacatcttatttgtgcagtctgac
tacacagaggcatataatcccaaaatgaaacgtgatgaacgaaccttaataaatgcagat
attaaagttgtagactttggaagtgcaacctatgatgatgaacatcacagtaccttggta
tctacaagacattatagggcgcctgaagttattttggccctaggatggtcccagccatgt
gatgtctggagtataggatgcattctcattgaatactaccttgggtttacagtatttcca
acacatgatagtaaggagcatttggcaatgatggaaaggattcttggacctttaccaaaa
catatgatacagaaaaccaggaaacgtaaatatttccatcatgatcgattagactgggat
gaacacagttctgctggcagatatgtttcacggcgctgtaaacctctgaaggaatttatg
ctctctcaggatgctgaacatgagcttctctttgacctcatcgagaaaatgttggagtat
gatccagctaaaaggattactctcaaagaagccttaaagcatcctttcttttacccccta
aaaaaagctacatag

DBGET integrated database retrieval system